KEGG   Caulobacter crescentus NA1000: CCNA_01836Help
Entry
CCNA_01836        CDS       T00841                                 

Definition
acyl-CoA thioesterase I/lysophospholipase (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ccs01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1968272..1968904
Genome map
AA seq 210 aa AA seqDB search
MSQTAHRFPNRRRFLLGIGLLSQIAAAPKPVVITVLGDSITAGLGLPAREAMPAQLQSAL
GRRGISAVVRPAGVSGDTSGGGLARLGFSVSKDTQLCVVALGGNDLLQGVDPAQTKANLR
GVLQKLKARNVRAVLVGVAAPARIGASYARDFNAIYPSLAKEFGVPLYANILAGVVGNPA
LMQRDGIHPNAQGAKKIGEALAAVVAKAVS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaccgcacaccgttttcccaaccgccgacgttttttgctggggatcggcctg
ctgagccagatcgccgccgcgccgaagccggtggtgatcaccgtgctcggcgactccatc
accgccgggctcggcttgcccgcgcgcgaggccatgcccgcgcagttacagtcagcgctg
gggcgacgtgggatctcagcggtcgtaagacccgccggcgtctcgggcgacacaagcggc
ggcggcttggcccggcttggcttcagcgtctcgaaggacacacaactctgcgtggtggcg
ctcggcggcaacgatctgctgcagggcgtcgatccggctcagaccaaggcgaaccttcgc
ggcgtgctgcagaagctcaaggcccggaacgtccgtgcggtgctggtcggcgtggccgcg
ccagccaggatcggcgccagctacgcgcgcgacttcaacgccatttatccgagcctggcc
aaggagttcggcgtgccgctttacgcgaatatcctcgcgggggtcgtcggcaatccggcg
ttgatgcagcgcgacggaattcatccgaacgctcagggcgccaagaagatcggcgaggcg
ctggccgctgtcgtcgccaaggcggtgagttag

DBGET integrated database retrieval system