KEGG   Caulobacter crescentus NA1000: CCNA_01836Help
Entry
CCNA_01836        CDS       T00841                                 

Definition
acyl-CoA thioesterase I/lysophospholipase (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CCNA_01836
Enzymes [BR:ccs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CCNA_01836
   3.1.2  Thioester hydrolases
    3.1.2.-  
     CCNA_01836
Lipid biosynthesis proteins [BR:ccs01004]
 Fatty acid synthase
  Component type
   CCNA_01836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1968272..1968904
Genome map
AA seq 210 aa AA seqDB search
MSQTAHRFPNRRRFLLGIGLLSQIAAAPKPVVITVLGDSITAGLGLPAREAMPAQLQSAL
GRRGISAVVRPAGVSGDTSGGGLARLGFSVSKDTQLCVVALGGNDLLQGVDPAQTKANLR
GVLQKLKARNVRAVLVGVAAPARIGASYARDFNAIYPSLAKEFGVPLYANILAGVVGNPA
LMQRDGIHPNAQGAKKIGEALAAVVAKAVS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaccgcacaccgttttcccaaccgccgacgttttttgctggggatcggcctg
ctgagccagatcgccgccgcgccgaagccggtggtgatcaccgtgctcggcgactccatc
accgccgggctcggcttgcccgcgcgcgaggccatgcccgcgcagttacagtcagcgctg
gggcgacgtgggatctcagcggtcgtaagacccgccggcgtctcgggcgacacaagcggc
ggcggcttggcccggcttggcttcagcgtctcgaaggacacacaactctgcgtggtggcg
ctcggcggcaacgatctgctgcagggcgtcgatccggctcagaccaaggcgaaccttcgc
ggcgtgctgcagaagctcaaggcccggaacgtccgtgcggtgctggtcggcgtggccgcg
ccagccaggatcggcgccagctacgcgcgcgacttcaacgccatttatccgagcctggcc
aaggagttcggcgtgccgctttacgcgaatatcctcgcgggggtcgtcggcaatccggcg
ttgatgcagcgcgacggaattcatccgaacgctcagggcgccaagaagatcggcgaggcg
ctggccgctgtcgtcgccaaggcggtgagttag

DBGET integrated database retrieval system