KEGG   Caulobacter crescentus NA1000: CCNA_01841Help
Entry
CCNA_01841        CDS       T00841                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCNA_01841
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CCNA_01841
Enzymes [BR:ccs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CCNA_01841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1972490..1974109
Genome map
AA seq 539 aa AA seqDB search
MTQRKTYAEHRDALLARYPQGVTPGGVDVDDIIQLKLQNTFNTHLDIARAMAPVMRADMA
EYDRDSSKFTQSLGCWSGFHAQQMIKAVKRLRGTTKGAYVYLSGWMVAGLRNRFGHLPDQ
SMHEKTSVVDLIEEIYVSLRQADEVAINDLFKALSAARKAGDQIAEQAAIKAIDNFETHV
VPIIADIDAGFGNEHATYLLAKEMIKAGACCLQIENQVSDAKQCGHQDGKVTVPREDFIE
KLRACRLAFEELGVDDGVIVARTDSLGAGLTQKIPVSQEPGDLASDYIKWLKTEPVTPEN
PLKDGELAIMKDGAFVKPVRMPNGLFAFQDGTGRQRVIEDCIANLTQGGADLLWIETDTP
NVDEIASMVAEVRRVVPNAKLTYNNSPSFNWTLNLRKQVRDQWIAEGKIHKDSYPDGNAL
MSAEYDKSDLGREADERLARFQVDIAARAGVFHNLITLPTFHLTAKSVDELSRGYFGEDR
MQAYVNTVQREEIRRGVSAVKHQHEVGSDLGDTFKEMVAGERALKAGGHANTMNQFAAE
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcgcaagacctatgccgaacaccgcgacgccctgctggcgcgctacccgcaa
ggcgtcacgccgggcggcgtcgatgtcgacgacatcatccagctgaagctgcaaaacacc
ttcaacacccacctggatatcgcccgcgccatggccccggtgatgcgcgccgacatggcc
gagtacgatcgcgacagctccaagttcacccagtcgctgggctgctggtcaggctttcac
gcccagcagatgatcaaggcggtcaaacgcctgcgcggcacgaccaagggcgcctatgtc
tatctgtcgggctggatggtcgcgggccttcgcaaccgcttcggccacctgcccgaccag
tcgatgcacgagaagacctcggtcgtcgacctgatcgaggaaatctacgtctcgctgcgc
caggccgacgaagtggcgatcaacgacctcttcaaggcgctgagcgccgcccgcaaggcc
ggcgaccagatcgccgagcaggcggcgatcaaggcgatcgacaacttcgagacccacgtc
gtgccgatcatcgccgacatcgacgccggcttcggcaacgagcacgcgacctatctgttg
gccaaggagatgatcaaggccggcgcctgctgcctgcagatcgagaaccaggtcagcgac
gccaagcaatgcggccaccaggacggcaaggtcaccgtgccgcgcgaggatttcatcgag
aagctgcgcgcttgccgcctggccttcgaggaactgggcgtggacgacggcgtcatcgtc
gcccgcaccgacagcctgggcgcaggcctgacccagaagatcccggtcagccaggagcct
ggcgatctggccagcgactacatcaagtggctgaagaccgagcccgtcaccccggaaaac
ccgctgaaggacggcgagctggcgatcatgaaggacggcgccttcgttaagcccgtgcgc
atgcccaacggcctgttcgcgttccaggacggcaccggccgccagcgcgtcattgaggac
tgcatcgccaacctgacccagggcggcgccgacctgctgtggatcgaaaccgacaccccc
aatgtcgatgagatcgcttcgatggtggccgaggttcgcagggtcgtgccgaacgccaag
ctgacctacaacaactcgccgtcgttcaactggacgctcaatctgcgcaagcaggttcgc
gaccagtggatcgccgagggcaagatccataaggacagctacccggacggcaatgcgctg
atgtcagccgagtacgacaagagcgacctgggccgcgaggccgatgagcgtctggcgcgc
ttccaggtcgacatcgccgcccgcgccggggtgttccacaacctgatcaccctgccgacc
ttccacttgaccgccaagagcgtggacgagctgtcgcgcggttacttcggcgaagatcgc
atgcaggcctacgtcaacacggtgcagcgcgaggagatccgccgcggcgtctccgccgtg
aaacaccagcacgaggtcggctcggatctcggcgacaccttcaaggagatggtcgccggc
gaacgcgccctgaaggccggcggccacgccaacaccatgaaccagttcgcggccgaatag

DBGET integrated database retrieval system