KEGG   Caulobacter crescentus NA1000: CCNA_01926Help
Entry
CCNA_01926        CDS       T00841                                 

Gene name
dgcB
Definition
(RefSeq) GGDEF diguanylate cyclase DgcB
  KO
K13590  diguanylate cyclase [EC:2.7.7.65]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
ccs04112  Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CCNA_01926 (dgcB)
Enzymes [BR:ccs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     CCNA_01926 (dgcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF DUF1664 CorA BAR_2 Cluap1 Spc7 Transcrip_act Fez1 DUF4515 GAS Ribosomal_S15 PRKG1_interact DMPK_coil CHDCT2 Gly_acyl_tr_N IFT20 APG6 IncA
Motif
Other DBs
NCBI-GeneID: 7330066
NCBI-ProteinID: YP_002517299
UniProt: A0A0H3CAN8
Position
2072620..2073681
Genome map
AA seq 353 aa AA seqDB search
MSDVETTLRGPEAYKIASRALELMERHQVWPTALNFELWTHYVADPNGALARELTRLISL
GEPMTELVSEELAATFLPKARLNEQIRDAGDILSKELEAVSKAIQNAQKSNAAFGQELAG
ASKSLDTHTDVASIKAVVGSIAEATRRVHKENQSLEARLADSTAEVERLREHLEQVRRDA
TTDGLTNLANRKAFDDELDRACAEAEEGGTTICLAVLDIDHFKGFNDTWGHQTGDQVIRY
VASVIGRVAAPPRFAARYGGEEFAMIFPREAASVVATTLEEIRVEVSSRMLKRRSTNEDL
GAITVSSGFAERKPGESGHSVMERADAALYASKRGGRNRVTAAESMPGAANAA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgtcgaaaccacgctgcgcggtccagaggcctacaagatcgcctcgcgcgct
ctggagcttatggaacggcatcaagtctggccgaccgcgctgaacttcgagctctggacg
cactatgtggccgacccgaatggcgcactggcgcgtgagctgacccgactgatctcgctg
ggcgagccgatgaccgaactggtcagcgaagagcttgccgcgacgttcctgcccaaggcg
cgcctgaacgaacagatccgcgatgcgggcgacattctgtccaaggaactggaggcggtt
tccaaggcgatccagaacgcccagaagtccaacgccgccttcggccaggaactggccggc
gcgagcaagagcctcgacacccataccgacgtcgcctcgatcaaggcggtggtcggcagc
atcgccgaagccacccgccgggtgcacaaggaaaaccagtcgctggaggcgcgtctcgcc
gactccaccgccgaagtcgaacgcctgcgcgaacatctggagcaggtgcgacgcgacgcc
acgaccgacggcctgaccaatctggccaaccgcaaggccttcgacgacgaactcgaccgc
gcctgcgccgaggccgaggaaggtggcacgaccatctgcctggcggtgctcgatatcgac
cacttcaagggcttcaacgatacctggggccaccagacgggcgaccaggtcatccgctat
gtcgcctcagtcatcggccgtgtcgccgccccgccccgcttcgccgcccgctacggcggc
gaggagttcgcgatgatcttcccccgcgaagccgcctcggtggtggcgaccacgctggag
gaaatccgcgtcgaggtgtcgtcgcgcatgctcaagcgccgctcgaccaacgaggacctg
ggcgcgatcacggtgtcctcggggttcgccgagcgtaagccgggcgagtcgggccactcg
gtgatggaacgggcggacgccgcgctctacgcctccaagcgtggtggccgcaatcgcgtg
acggccgcggagtccatgcccggcgccgccaacgccgcctga

DBGET integrated database retrieval system