KEGG   Caulobacter crescentus NA1000: CCNA_01926Help
Entry
CCNA_01926        CDS       T00841                                 

Gene name
dgcB
Definition
GGDEF diguanylate cyclase DgcB
Orthology
K13590  
diguanylate cyclase
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Cell cycle - Caulobacter
Class
Cellular Processes; Cell growth and death; Cell cycle - Caulobacter [PATH:ccs04112]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2072620..2073681
Genome map
AA seq 353 aa AA seqDB search
MSDVETTLRGPEAYKIASRALELMERHQVWPTALNFELWTHYVADPNGALARELTRLISL
GEPMTELVSEELAATFLPKARLNEQIRDAGDILSKELEAVSKAIQNAQKSNAAFGQELAG
ASKSLDTHTDVASIKAVVGSIAEATRRVHKENQSLEARLADSTAEVERLREHLEQVRRDA
TTDGLTNLANRKAFDDELDRACAEAEEGGTTICLAVLDIDHFKGFNDTWGHQTGDQVIRY
VASVIGRVAAPPRFAARYGGEEFAMIFPREAASVVATTLEEIRVEVSSRMLKRRSTNEDL
GAITVSSGFAERKPGESGHSVMERADAALYASKRGGRNRVTAAESMPGAANAA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgtcgaaaccacgctgcgcggtccagaggcctacaagatcgcctcgcgcgct
ctggagcttatggaacggcatcaagtctggccgaccgcgctgaacttcgagctctggacg
cactatgtggccgacccgaatggcgcactggcgcgtgagctgacccgactgatctcgctg
ggcgagccgatgaccgaactggtcagcgaagagcttgccgcgacgttcctgcccaaggcg
cgcctgaacgaacagatccgcgatgcgggcgacattctgtccaaggaactggaggcggtt
tccaaggcgatccagaacgcccagaagtccaacgccgccttcggccaggaactggccggc
gcgagcaagagcctcgacacccataccgacgtcgcctcgatcaaggcggtggtcggcagc
atcgccgaagccacccgccgggtgcacaaggaaaaccagtcgctggaggcgcgtctcgcc
gactccaccgccgaagtcgaacgcctgcgcgaacatctggagcaggtgcgacgcgacgcc
acgaccgacggcctgaccaatctggccaaccgcaaggccttcgacgacgaactcgaccgc
gcctgcgccgaggccgaggaaggtggcacgaccatctgcctggcggtgctcgatatcgac
cacttcaagggcttcaacgatacctggggccaccagacgggcgaccaggtcatccgctat
gtcgcctcagtcatcggccgtgtcgccgccccgccccgcttcgccgcccgctacggcggc
gaggagttcgcgatgatcttcccccgcgaagccgcctcggtggtggcgaccacgctggag
gaaatccgcgtcgaggtgtcgtcgcgcatgctcaagcgccgctcgaccaacgaggacctg
ggcgcgatcacggtgtcctcggggttcgccgagcgtaagccgggcgagtcgggccactcg
gtgatggaacgggcggacgccgcgctctacgcctccaagcgtggtggccgcaatcgcgtg
acggccgcggagtccatgcccggcgccgccaacgccgcctga

DBGET integrated database retrieval system