KEGG   Caulobacter crescentus NA1000: CCNA_01970Help
Entry
CCNA_01970        CDS       T00841                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCNA_01970
   01230 Biosynthesis of amino acids
    CCNA_01970
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCNA_01970
   00051 Fructose and mannose metabolism
    CCNA_01970
   00562 Inositol phosphate metabolism
    CCNA_01970
Enzymes [BR:ccs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CCNA_01970
Exosome [BR:ccs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CCNA_01970
  Exosomal proteins of bladder cancer cells
   CCNA_01970
  Exosomal proteins of melanoma cells
   CCNA_01970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2114516..2115277)
Genome map
AA seq 253 aa AA seqDB search
MTLSSTTPRPLIAGNWKMNGLSVALDEARAVAAALEAKPPAARVAIFPPATLLHRLSQAV
EGAHLLTGGQDCHGKSSGAHTGDVSAEMVADAGGSLVICGHSERRTDHGETSAQVAGKAE
AAAAAGLEPIVCVGETLETREAGQAVSFVVSQVRDSLPTSLAGKAFSVAYEPLWAIGTGR
TASVDNIVEMHAAIRAELVSRFCEQGRTVLILYGGSVKPENAREILAAPEVGGALVGGAS
LKAKDFLAIIQAL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaccctttcgagcacaacgccccggcctctgatcgccggaaactggaagatgaacggc
ctttcggtcgccctcgacgaggcccgagccgtcgccgccgccctggaggcgaaacctccg
gccgcccgcgtcgcgatcttcccgcccgccaccctgttgcatcgtctgagccaggcggtg
gaaggggcgcatctccttaccggcggtcaggattgccatggcaagtcgagcggcgcgcat
acgggcgatgtctccgccgagatggtcgcggacgcaggcggatcgctggtgatctgcggc
cactccgagcggcgcactgaccacggtgaaacctcagcccaggtggccggaaaggctgaa
gccgccgccgcggcgggcctggagccgatcgtctgcgtcggcgagaccctggagacccgt
gaagcgggccaggcggtaagctttgtcgtgagccaggtgcgggactcgctgccaacctcg
ctggccggcaaggcgttcagcgtggcctatgagcctctgtgggcgatcggcacgggccga
acggcttcggtcgacaacatcgtcgagatgcacgcggccatccgcgccgagctggtctcc
cgtttctgcgagcagggccggaccgtcctgatcctctatggtggctccgtgaagcccgaa
aacgctcgcgagatcctcgccgcgcccgaggttggtggcgcgctggtcggcggcgcttcg
ctgaaggccaaggacttcctggcgatcatccaggcgctttaa

DBGET integrated database retrieval system