KEGG   Caulobacter crescentus NA1000: CCNA_02076Help
Entry
CCNA_02076        CDS       T00841                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ccs  Caulobacter crescentus NA1000
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2226974..2227642)
Genome map
AA seq 222 aa AA seqDB search
MSGGTTKAAENAKADLPRLMKALRDQGVTDPQVLKAIETTPRDLFTPDLFKDRSWEDSAL
PIACGQTISQPYIVGLMTQALTVEPRSRVLEIGTGSGYQTTILSKVSRLVYTIERYRTLM
KEAEARFNTLGLTNVITKFGDGGEGWAEQAPFDRIMVTAAAEDDPKRLLSQLKPNGVLVA
PVGKGPVQSLRRYAGDGKGGFRVEILCDVRFVPLLAGVAKDQ
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagcggagggacgacgaaggccgccgagaacgccaaggccgatctgccgcgcctgatg
aaggcgttgcgcgaccagggcgtcaccgatcctcaggtgctcaaggccatcgagaccacg
ccgcgcgacctgttcacgcccgacctcttcaaggaccgctcgtgggaagattcggccctg
ccgatcgcctgcggccagaccatcagccaaccctatatcgtcggcctgatgacccaggcc
ctgacggtcgagccgcgctcgcgggtgctggagatcggcaccggctcgggctaccagacg
acgatcctgagcaaggtgtcgcggctggtctatacgatcgagcgctatcgcaccctgatg
aaggaagccgaagcgcgcttcaacacgctgggtttgaccaatgtcatcaccaagttcggc
gatggcggcgaaggctgggccgaacaggcgccgtttgaccgcattatggtcacggctgcg
gcggaagatgatccaaagcggctgctctcgcagctgaagccgaacggcgtgctggtcgcg
ccggtcggcaaggggcctgtccagagccttcggcgctacgccggagacggcaagggcggc
ttccgggtcgagattctctgcgacgtacgcttcgtgcccctgctggccggcgtcgccaag
gatcagtga

DBGET integrated database retrieval system