KEGG   Caulobacter crescentus NA1000: CCNA_02085Help
Entry
CCNA_02085        CDS       T00841                                 

Definition
anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase (EC:3.2.1.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ccs00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ccs00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2234353..2235390)
Genome map
AA seq 345 aa AA seqDB search
MSLLMGAPSAAILGCAGTTLTAEEVAFFKDVKPWGFILFKRNIADPNQVRALTAALRETV
GRADAPILIDQEGGRVARLQPPHWRTYPPGRAYGELVANDPLVAREITRLGARLIAHDLH
ALGINVDCVPVLDVPDPKGHEIIGDRAYGDTPEQVATLGRAAAEGLLAGGVLPIIKHIPG
HGRAMADSHLELPVVNAKLAELDARDFAPFRVLSDMPMAMTAHVVYTAIDRKNPATTSKK
AIKKIIRESIGFDGLLMSDDLSMKALSGDFKQRAKDSLSAGCDVVLHCNGDMAEMKAVMS
GVGRMGKEARRRAQAVMGRLVKVPEPFDVAEARARFDAAFDGKYA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgagccttctgatgggcgcgccttccgccgctattctcggctgcgccgggacgaccctg
acggccgaagaggtcgccttcttcaaggacgtgaagccctggggcttcatcctgttcaag
cgcaacatcgccgaccccaaccaggtgcgcgccctgaccgccgccctgcgcgagacggtc
ggccgtgcggatgcgccgatcctgattgaccaggagggggggcgtgtcgcgcgccttcag
ccgccgcattggcgcacctatccgcctggccgcgcctatggcgagctggtcgccaacgat
ccgctggtcgcgcgcgagatcacgcgcctgggcgctcgtctgatcgctcatgaccttcac
gcgctggggatcaatgtcgactgcgtgccggtgctggatgttcccgaccccaagggccac
gagatcatcggcgaccgcgcctatggcgacacgcccgagcaggtggcgaccctgggccgt
gcggcggcggagggtctgctggccggcggcgtgctgccgatcatcaagcatatccccggc
cacggtcgcgccatggccgacagccatctggaactgccggtggtgaacgccaagctggcc
gagctggacgcccgcgacttcgcgccgttccgcgtgctgtcggacatgccgatggcgatg
accgcgcacgttgtctacacggcgatcgaccgcaagaacccagccacgacctcgaagaag
gcgatcaagaagatcatccgcgagtcaatcggcttcgacggacttctgatgagcgatgac
ctgtcgatgaaggcgctgtcgggcgacttcaagcagcgggccaaggacagcttgagcgcc
ggttgcgacgtcgtcctgcactgcaatggcgacatggccgagatgaaggccgtgatgtcc
ggtgtcgggcggatgggcaaggaagcccgtcgccgcgcccaggcggtcatggggcgcctg
gtcaaggtccccgaaccgttcgacgttgccgaggcccgggcgcgcttcgacgcggccttc
gacggaaagtacgcttga

DBGET integrated database retrieval system