KEGG   Caulobacter crescentus NA1000: CCNA_02085Help
Entry
CCNA_02085        CDS       T00841                                 

Definition
(RefSeq) anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
ccs00520  Amino sugar and nucleotide sugar metabolism
ccs01100  Metabolic pathways
ccs01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CCNA_02085
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    CCNA_02085
Enzymes [BR:ccs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CCNA_02085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 HHV-1_VABD
Motif
Other DBs
NCBI-GeneID: 7330391
NCBI-ProteinID: YP_002517458
UniProt: A0A0H3C9G9
Position
complement(2234353..2235390)
Genome map
AA seq 345 aa AA seqDB search
MSLLMGAPSAAILGCAGTTLTAEEVAFFKDVKPWGFILFKRNIADPNQVRALTAALRETV
GRADAPILIDQEGGRVARLQPPHWRTYPPGRAYGELVANDPLVAREITRLGARLIAHDLH
ALGINVDCVPVLDVPDPKGHEIIGDRAYGDTPEQVATLGRAAAEGLLAGGVLPIIKHIPG
HGRAMADSHLELPVVNAKLAELDARDFAPFRVLSDMPMAMTAHVVYTAIDRKNPATTSKK
AIKKIIRESIGFDGLLMSDDLSMKALSGDFKQRAKDSLSAGCDVVLHCNGDMAEMKAVMS
GVGRMGKEARRRAQAVMGRLVKVPEPFDVAEARARFDAAFDGKYA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgagccttctgatgggcgcgccttccgccgctattctcggctgcgccgggacgaccctg
acggccgaagaggtcgccttcttcaaggacgtgaagccctggggcttcatcctgttcaag
cgcaacatcgccgaccccaaccaggtgcgcgccctgaccgccgccctgcgcgagacggtc
ggccgtgcggatgcgccgatcctgattgaccaggagggggggcgtgtcgcgcgccttcag
ccgccgcattggcgcacctatccgcctggccgcgcctatggcgagctggtcgccaacgat
ccgctggtcgcgcgcgagatcacgcgcctgggcgctcgtctgatcgctcatgaccttcac
gcgctggggatcaatgtcgactgcgtgccggtgctggatgttcccgaccccaagggccac
gagatcatcggcgaccgcgcctatggcgacacgcccgagcaggtggcgaccctgggccgt
gcggcggcggagggtctgctggccggcggcgtgctgccgatcatcaagcatatccccggc
cacggtcgcgccatggccgacagccatctggaactgccggtggtgaacgccaagctggcc
gagctggacgcccgcgacttcgcgccgttccgcgtgctgtcggacatgccgatggcgatg
accgcgcacgttgtctacacggcgatcgaccgcaagaacccagccacgacctcgaagaag
gcgatcaagaagatcatccgcgagtcaatcggcttcgacggacttctgatgagcgatgac
ctgtcgatgaaggcgctgtcgggcgacttcaagcagcgggccaaggacagcttgagcgcc
ggttgcgacgtcgtcctgcactgcaatggcgacatggccgagatgaaggccgtgatgtcc
ggtgtcgggcggatgggcaaggaagcccgtcgccgcgcccaggcggtcatggggcgcctg
gtcaaggtccccgaaccgttcgacgttgccgaggcccgggcgcgcttcgacgcggccttc
gacggaaagtacgcttga

DBGET integrated database retrieval system