KEGG   Caulobacter crescentus NA1000: CCNA_02133Help
Entry
CCNA_02133        CDS       T00841                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCNA_02133 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCNA_02133 (glk)
   00052 Galactose metabolism
    CCNA_02133 (glk)
   00500 Starch and sucrose metabolism
    CCNA_02133 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CCNA_02133 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CCNA_02133 (glk)
   00524 Butirosin and neomycin biosynthesis
    CCNA_02133 (glk)
Enzymes [BR:ccs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CCNA_02133 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2289247..2290242)
Genome map
AA seq 331 aa AA seqDB search
MDGNHSGGLGLVGDIGGTNARFALVEFDGQDPRLIEPTAYRGEDYGTAEDAIEEYLRKVG
VKHPDQAVVAVAGPIDHGQVHMTNLDWRISEDGLRRAGGFRNAKLINDFTAQALAAPRVG
PKDLRQIGELPTSGEGDLAILGPGTGFGVAGLVRRHGQEIPLATEGGHVAFAPVDDVEIE
VLRALTRRLDGGRVSVERILSGPGMEDLHVDLAAAEGRGVEALTAKQITERAVEGCADSL
ATVNRFCAILGSTAGDIALTLGARGGVFIAGGIAPRIIDILEKSPFRERFDSKGRLSGFT
RSIPTHVILHPHTALIGAAVALTPEGRAAVS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggacggcaatcacagcggcgggctcggcctcgtcggcgacatcggcggtacgaacgcc
cgcttcgccctggtcgagttcgacggtcaggacccgcgcctgatcgagccgacggcctat
aggggcgaggactacggcacggccgaggacgccatcgaggagtatctccgcaaggtcggt
gtcaagcatcctgaccaggcggtggtcgctgtggccgggccgatcgaccacggtcaggtc
cacatgaccaatctggactggcggatctccgaggacggcctgcgccgcgcaggcggtttt
cggaacgccaagctgatcaacgacttcaccgcccaggcgctggccgcgccgcgcgttggc
cctaaggacctgcgccagatcggcgaattgccgacgtcgggggagggcgatctggcgatc
ctgggtccaggcaccggcttcggcgtcgcaggccttgtccgtcgccatggccaggagatc
ccgctggccaccgagggtggtcacgtcgccttcgcgccggtcgatgacgtcgagatcgag
gtgctccgcgccctgacccggcgcctggacggcggtcgggtgtcggtcgagcggatcctg
tcgggtcccggcatggaggacctccatgtggatctggcggccgctgaagggcgcggtgtc
gaggcgctgaccgccaagcagatcaccgagcgggccgtagagggctgcgccgacagcctg
gcgacggtgaaccgtttctgcgccatcctgggctcaacggcgggcgacatcgctctgacc
ttgggcgcacgcggcggtgttttcatcgccggcggcatcgcaccacgcatcatcgacatt
ctggagaagagcccgttccgcgagcgcttcgacagcaaggggcgtctgtccggcttcacc
cgttcgatcccgacgcacgtgatcctgcatccgcacaccgccctgatcggtgcggcggtg
gcgctcacgccggagggccgtgcggcggtgtcgtag

DBGET integrated database retrieval system