KEGG   Caulobacter crescentus NA1000: CCNA_02255Help
Entry
CCNA_02255        CDS       T00841                                 

Gene name
spmX
Definition
lysozyme-family localization factor spmX (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ccs  Caulobacter crescentus NA1000
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2405880..2407175)
Genome map
AA seq 431 aa AA seqDB search
MKPRHQVSRAAVDLIKRFEGYRQKAAQLPDGRWTVGYGHTLTAREGASVSEKDAEALLLY
DLISVAHSVNEHTYTPLNQNQFDALVCFAFNIGLDNFLRSGVLRRINEGSLLQAACAMEM
WRKADFEGERIVIDALVRRRSAEKTLFLTPANGEWVPAPSPVLRPKVDYDASCAVPKQTP
ATVNTRTEGDRVIAQREEGLPLNVVVPEEDAPTATEQSAAAVAARLEAILPETPSAPASM
AKPAMRQDDLGLPEPPAPTQPAAMEPAPVLFEAEPQPAPVEPPPAAPVEFTPFRLTPQAS
EQAEAPVEAPAPTRPAPSEPTLFGAPATGSSVFNLDGFSTSEDATVGVMDVPLVEPEPPR
FGNTSLLISLGILGLALFGGGVLWILTVAAGSDGQVKLFGYGASMVGAICFVVSAYLLLR
RLAGPDVSDEE
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgcgtcatcaggtctcccgggccgccgtcgatctcatcaagagattcgaaggg
taccgtcagaaggccgcgcagctccccgacgggcgctggacggtcggctatggccacacc
ctgaccgcccgcgagggcgcctctgtctcggaaaaggacgccgaggcgctgctgctctat
gatctcatctcggtcgcccattcggtgaacgagcacacctacacgccgctgaaccagaac
cagttcgacgcgttggtgtgcttcgccttcaatatcggcctcgacaacttcctccgctcg
ggcgtcctgcgccggatcaacgagggctcgctgctgcaagccgcgtgcgcgatggagatg
tggcgcaaggccgatttcgagggcgagcgcatcgtcatcgatgcactggttcgccgccgc
tccgccgagaagactctgttcctcacgccggccaacggcgaatgggtccccgcgcccagc
cccgtgctgcgtcccaaggtcgactatgacgccagctgcgcggtgcccaagcagacgccg
gccaccgtcaacacccgcaccgaaggcgaccgtgtcatcgcccagcgcgaggaaggcctg
ccgctgaacgtggtcgtcccggaagaggacgctccgaccgccaccgagcaatcggccgct
gcggtcgctgcgcgcctggaagcgatcttgccggaaacgccgtcggcgcccgcgtcgatg
gccaagccggccatgcgccaggatgatctgggcctgcccgaaccgccggccccgacgcaa
cctgccgcgatggagccggcgccggtgctgttcgaggccgagccgcagcccgcgccggtc
gaaccgccgccggccgctccggtcgagttcacgccgttccgcctgacgccacaagcttct
gaacaggccgaggctccggtcgaggcgccggccccgacgcgtcccgcgccgagcgagccg
accctgttcggcgcgccggccaccggctcgtcggtctttaatctggacggcttctcgacc
agcgaggacgcaaccgtcggcgtgatggacgtgccgctggtggagccggagccgccccgc
tttggcaacaccagcctgctgatcagcctgggcatcctgggtctggccctgttcggcggc
ggcgtcctctggatcctgaccgtcgcggcgggctcggatggccaggtcaagctcttcggc
tacggcgccagcatggtcggcgcgatctgcttcgtggtctcggcctatctgctgctgcgc
cgtctggcgggccccgatgtgagcgacgaagagtag

DBGET integrated database retrieval system