KEGG   Caulobacter crescentus NA1000: CCNA_02344Help
Entry
CCNA_02344        CDS       T00841                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCNA_02344
   01230 Biosynthesis of amino acids
    CCNA_02344
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCNA_02344
  Energy metabolism
   00680 Methane metabolism
    CCNA_02344
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCNA_02344
Enzymes [BR:ccs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CCNA_02344
Exosome [BR:ccs04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CCNA_02344
  Exosomal proteins of melanoma cells
   CCNA_02344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2484136..2484849)
Genome map
AA seq 237 aa AA seqDB search
MPTLVLLRHGQSQWNLENRFTGWVDVDLTAEGEAQARKGGELIAAAGIEIDRLFTSVQTR
AIRTGNLALDAAKQSFVPVTKDWRLNERHYGGLTGLNKAETAEKHGVEQVTIWRRSYDIP
PPELAPGGEYDFSKDRRYKGASLPSTESLATTLVRVLPYWESDIAPHLKAGETVLIAAHG
NSLRAIVKHLFNVPDDQIVGVEIPTGNPLVIDLDAALKPTGARYLDDSRAEALPKVG
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgctcgtcctgctgcgccatggccaaagccagtggaacctggaaaaccgcttc
accggttgggttgatgtggacctcaccgctgagggcgaagctcaggcccggaagggcggc
gagctgatcgctgcggccggcatcgagatcgaccgcttgttcacctcggttcagacccgc
gccatccgcacaggcaatctggcgctggacgccgccaagcagagcttcgtccccgtgacc
aaggactggcgcctgaacgagcgccactatggcgggctgaccggcctgaacaaggctgag
accgccgaaaagcacggcgtcgagcaggtgaccatctggcgccgttcgtacgatatcccg
ccgccggagctggcgccgggcggcgagtacgacttcagcaaggatcgccgctacaagggc
gcaagcctgcccagcacggaaagcctggcgacgacgctggttcgcgttctgccctactgg
gaaagcgacatcgctccgcatctcaaggcgggtgagactgtgctgatcgccgcccacggc
aactcgctgcgcgccatcgtcaagcatctgttcaacgtgccggacgaccagatcgtcggt
gtggagattccgaccggcaatccgctggtgatcgacctggatgctgcgttgaagccgacc
ggcgcgcgctacctggacgacagtcgggctgaggcgcttcccaaagttggttaa

DBGET integrated database retrieval system