KEGG   Caulobacter crescentus NA1000: CCNA_02347Help
Entry
CCNA_02347        CDS       T00841                                 

Definition
phosphomannomutase/phosphoglucomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCNA_02347
   00030 Pentose phosphate pathway
    CCNA_02347
   00051 Fructose and mannose metabolism
    CCNA_02347
   00052 Galactose metabolism
    CCNA_02347
   00500 Starch and sucrose metabolism
    CCNA_02347
   00520 Amino sugar and nucleotide sugar metabolism
    CCNA_02347
  Nucleotide metabolism
   00230 Purine metabolism
    CCNA_02347
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CCNA_02347
Enzymes [BR:ccs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CCNA_02347
    5.4.2.8  phosphomannomutase
     CCNA_02347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2486278..2487774
Genome map
AA seq 498 aa AA seqDB search
MFSSPRADLVPNTAAYENEALVKATGFREYDARWLFGPEINLLGVQALGLGLGTYIHELG
QSKIVVGHDFRSYSTSIKNALILGLISAGCEVHDIGLALSPTAYFAQFDLDIPCVAMVTA
SHNENGWTGVKMGAQKPLTFGPDEMSRLKAIVLNAEFVERDGGKLIRVQGEAQRYIDDVA
KRASVTRPLKVIAACGNGTAGAFVVEALQKMGVAEVVPMDTDLDFTFPKYNPNPEDAEML
HAMADAVRETGADLAFGFDGDGDRCGVVDDEGEEIFADKIGLMLARDLAPLHPGATFVVD
VKSTGLYATDPILAQHGCKVIYWKTGHSYIKRKSAELGALAGFEKSGHFFMNGELGYGYD
CGLTAAAAILAMLDRNPGVKLSDMRKALPVAFTSLTMSPHCGDEVKYGVVADVVKEYEDL
FAAGGSILGRKITEVITVNGVRVHLEDGSWVLVRASSNKPEVVVVVESTQSEDDMRALFR
QEVKPRLGDRVGKYNQEI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgttctcctcgccccgcgccgatctggttccgaatacggccgcctacgaaaacgaagcc
ctggtcaaggcgacgggctttcgcgagtacgacgcgcgctggctgtttgggccggagatc
aatctcctgggcgtgcaggccctgggcctgggtctgggaacctatatccacgaactgggc
caatcgaagatcgtggtcggccatgacttccgctcgtattcgacctcgatcaagaacgcc
ctgatcctggggctgatcagcgccggctgcgaggtgcacgacattggcctggccctgtcg
cccaccgcctatttcgcccagttcgacctcgacatcccgtgcgtggccatggtcacggcc
agccacaacgaaaacggctggaccggcgtgaagatgggcgcccagaagccgctgaccttc
ggccccgacgagatgagccgcctcaaggccatcgtgctgaacgccgagttcgtcgagcgc
gatggcggcaagctgatccgcgtgcagggcgaggcccagcgctatatcgacgacgtggcc
aagcgcgccagcgtcacccgtcccctgaaggtgatcgccgcctgcggcaacggcacggcc
ggcgccttcgtggtcgaggccctgcagaagatgggtgtcgctgaggtcgtgccgatggac
accgacctcgacttcaccttccccaagtacaatcccaaccccgaagacgccgagatgctg
cacgcgatggctgacgctgtccgtgagacgggcgcggacctggcgttcggcttcgacggc
gacggcgaccgctgcggtgtggtcgatgacgagggcgaggagatcttcgccgacaagatc
ggcctgatgctggcgcgcgacctggccccgctacatccgggcgcgaccttcgtcgtggat
gtgaagtcgacgggcctctacgccaccgatccgatcctggcccagcacggctgcaaggtg
atctactggaagaccggccacagctacatcaagcgcaagagcgcggagctgggcgccctg
gccggcttcgaaaagagcggccacttcttcatgaacggcgagctgggctatggctacgac
tgcggcctgaccgccgccgcggccatcctggccatgctggaccgcaatcccggcgtgaag
ctgtcggacatgcgcaaggccctgccggtggccttcacctccctgaccatgagcccgcac
tgcggtgacgaggtgaagtacggcgtcgtcgccgacgtggtgaaggaatacgaggacctg
ttcgccgccggcggttcgatcctgggccgcaagatcaccgaggtgatcacggtcaacggc
gtgcgggtgcacctggaggacggctcctgggtcctggtccgcgcctcgtccaacaagccc
gaggtcgtcgtcgtggtcgaaagcacccagtccgaagacgacatgcgcgccctcttccgc
caggaggtcaagccgcgcctgggcgaccgggtcggcaagtacaatcaggaaatctga

DBGET integrated database retrieval system