KEGG   Caulobacter crescentus NA1000: CCNA_02525Help
Entry
CCNA_02525        CDS       T00841                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CCNA_02525
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CCNA_02525
Enzymes [BR:ccs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CCNA_02525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2673609..2674607
Genome map
AA seq 332 aa AA seqDB search
MTASAHDPAREAIETIRARVFAFPKRHFLSAGDLNAPQAADLLDLADAFVALNRQTSKTL
DILKGRTLMNLFFENSTRTQSSFELAGKRLGADVVNMNPKTSSVAKGETLIDTAVTLNAM
RPDLLVVRHASSGAASLLSQKVSGHVVNAGDGQHEHPTQALLDALSIRRAFGRVSGLTVA
ICGDVLHSRVARSNVALLHTLGASVRLVGPPTLMPAQAERWGVAVHHDMKSGLAGADVVM
MLRLQLERMQGAFVPSTREYFRFYGLDREKLSRAAPGAKVMHPGPMNRGVEIDSDVADDP
AVSLIQDQVEMGVAARMAVLASLAARIEGAGR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacggcttccgcccatgaccccgcccgcgaggcgatcgagacgatccgcgcccgcgtc
ttcgcctttcccaagcgccatttcctgtcggccggcgatctgaacgcgcctcaggcggcc
gatctgctggatctggccgacgcgttcgtggccctgaaccggcaaacgtccaagaccctg
gatattctcaagggccggacgctgatgaacctgttcttcgagaacagcacccgcacccag
agctcgttcgagctggcgggcaagcgtctgggcgccgacgtcgtcaacatgaaccccaag
acctcgtcggtcgccaagggcgagaccctgatcgacacggccgtcaccctgaacgccatg
cggcccgacctcttggtcgtccgccacgcctcgtccggcgcggccagcctactgagccaa
aaggtcagcggccacgtcgtcaacgccggcgacggccagcacgagcacccgacccaggcc
ctcctggacgccctgtcgatccgacgcgcctttggccgcgtgtcgggcctgactgtggcg
atctgcggcgacgtgctgcacagccgcgtggcgcgttcgaacgtcgccttgctgcacacc
ctgggcgccagcgtgcgtctggtgggaccgcccaccctgatgccggcccaggccgagcgc
tggggcgtggccgtgcaccacgacatgaagtcgggcctggccggcgccgacgtcgtcatg
atgctgcgcctgcagctggagcgcatgcagggcgccttcgtgccttcgacccgtgaatac
ttccgcttttacggccttgaccgggagaagctctcccgcgctgcgcctggcgccaaggtc
atgcacccaggcccgatgaaccggggcgtcgagatcgactccgacgtcgccgacgatccg
gccgtaagcctgatccaggaccaggtcgagatgggcgtcgccgcccggatggcggtgctg
gcgagcctggcggccaggatcgagggggctggtcgatga

DBGET integrated database retrieval system