KEGG   Caulobacter crescentus NA1000: CCNA_03137Help
Entry
CCNA_03137        CDS       T00841                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ccs  Caulobacter crescentus NA1000
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3284568..3285626
Genome map
AA seq 352 aa AA seqDB search
MSRLTRRSAIASALALSACAREVQSQPVADTPLKSIASTPVGACLQRHQLDDPAFAALLT
RHYSQITAEWEMKMEYILQDDGRFRFDRPDAIADFARRHGLRLHGHALIWYSQVMPAFRA
LDGQGKRFADAYRNYILAVAGRYRGLAASWDVINEAVDDNGVDLRRSAWTDNLGVDEHMI
LAFHHAKEADPDAVLFINDYNLENNPTKRATFLRMVERLLKAGAPIGGIGTQSHLGLDFT
PPGMCRIALRDLASLGLPIHVSELDISFGDKPETAPLPKLLSRQADLARELAQAYMDLPR
AQRFAFTVWGVRDRDSWLRGANGERPWEHPLPLDDAGQPKPMFQALAEVLSG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacggctcacccgccgcagcgcgatcgcctccgccctggcgctgagcgcctgcgcg
cgtgaggtgcagagccagcccgtcgccgacacgcctctgaagtcgatcgcctcgaccccg
gtcggcgcctgcctgcagcgccaccagctggacgatcccgccttcgccgccctgctcacc
cgccactacagccagatcacggccgagtgggaaatgaagatggagtacatcctccaggac
gacgggcggttccggttcgaccggcccgacgccatcgccgacttcgcccgccgccacggc
ctgcggctgcatggccacgccctgatctggtacagtcaggtgatgcccgccttccgcgcc
ctggacggccagggcaagcggttcgccgacgcctatcgcaactacatcctggcggtcgcg
ggccgctatcgcgggctggcggccagctgggacgtcattaacgaggcggtcgacgacaac
ggcgtcgacctgcgacgctcggcctggaccgacaatctgggcgtcgatgagcacatgatc
ctggcgtttcaccacgccaaggaggccgaccccgacgcggtcctgttcatcaacgactac
aatctcgagaacaatccgaccaagcgggcgaccttcctgcggatggtcgaacggctgctg
aaggccggcgcgccgatcggcggcatcggcacccagagccatctgggtctggacttcacc
ccgccggggatgtgccggatcgccctgcgcgatctggccagccttggcctgccgatccat
gtctccgagctggacatctccttcggcgacaagccagaaaccgcccccttgccgaagctg
ctgagccgccaggccgacctcgcccgcgagctggcgcaggcctatatggacctgccgcgc
gcgcagcggttcgccttcaccgtctggggcgtgcgcgaccgggactcctggctgcgcggc
gcgaacggcgagcgcccctgggagcaccccttgcccctcgatgacgccggccagcccaag
ccgatgttccaggccctggctgaggtgctgtcggggtag

DBGET integrated database retrieval system