KEGG   Caulobacter crescentus NA1000: CCNA_03269Help
Entry
CCNA_03269        CDS       T00841                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCNA_03269
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCNA_03269
   00052 Galactose metabolism
    CCNA_03269
   00500 Starch and sucrose metabolism
    CCNA_03269
   00520 Amino sugar and nucleotide sugar metabolism
    CCNA_03269
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CCNA_03269
   00524 Butirosin and neomycin biosynthesis
    CCNA_03269
Enzymes [BR:ccs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CCNA_03269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3438397..3439374
Genome map
AA seq 325 aa AA seqDB search
MAKGSVLLADVNGRDLALALVSPGDAPRGHRDLACASLKALEEHLIDAVSEHSADGLIGA
AVCGAGPEIDGAIALTAGDFTLTQAWLRAVLKTPRVSLLNDFAACALGAPRLAPSAMRLI
HEGKPGRNAQIAVIGPNLGLGVAALTPHRTDGWTPVVSEGGHIDFTPGEPREVPVFEALQ
ARHGRVSAEHFLSQQGLADIYAALGGGLDDSDEVILARVRDGDETAREALSIFSALLGAF
AGDAALSFAARGGVYINSPLMERIDGLLDQAAFSRRFEDKGRMSAYLKDIPVYLAVGRCT
LLGLSALFTASDLRYEAAEVKVLDC
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggccaagggatcggtcctgctcgccgacgtgaatggtcgcgatctggccctggcgctg
gtcagtccgggcgacgcgccgcgcggacatcgcgatctagcctgcgcgtcgctcaaagcg
cttgaagagcacctgatcgacgccgtgtccgagcattcggctgacggcctgatcggagcc
gctgtctgcggcgccggccccgaaatcgacggcgcgatcgcgctgacggccggcgacttc
acgctgacccaggcctggttgcgcgcggtgctgaagacgccgcgcgtctcgctgttgaac
gacttcgccgcctgcgccctgggcgcgccccgcctggccccgtcggccatgcgcctgatc
cacgagggcaagcccggccgcaacgcccagatcgccgtgatcggtcccaatctcggtctc
ggcgtcgccgccctgacgccccaccgaaccgacgggtggacgcccgtagtcagcgagggt
gggcatatcgacttcacccccggcgagccccgcgaagtcccggtgttcgaggcgctgcaa
gcccggcacggccgggtctcggcggagcatttcctgtcacagcagggcctcgccgatatc
tatgcggccctgggcggcgggctggacgatagcgacgaggtcatcctcgcccgggtccgg
gacggcgacgagacggcgcgggaagccctgtcgatcttcagcgccctcttgggggccttc
gcgggagacgccgccctcagcttcgcggcccggggaggcgtctatatcaacagccccctg
atggaacgcatcgatggcctgctcgatcaggccgccttcagccggcgctttgaggacaag
ggccggatgagcgcctatctcaaggacatcccggtctatctcgccgtcgggcggtgcacg
ctgctgggcttgtccgcgctcttcaccgccagcgacctgcgatacgaagccgccgaggtg
aaggtcctcgactgctga

DBGET integrated database retrieval system