KEGG   Caulobacter crescentus NA1000: CCNA_03269Help
Entry
CCNA_03269        CDS       T00841                                 

Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
ccs00010  Glycolysis / Gluconeogenesis
ccs00052  Galactose metabolism
ccs00500  Starch and sucrose metabolism
ccs00520  Amino sugar and nucleotide sugar metabolism
ccs00521  Streptomycin biosynthesis
ccs01100  Metabolic pathways
ccs01110  Biosynthesis of secondary metabolites
ccs01120  Microbial metabolism in diverse environments
ccs01130  Biosynthesis of antibiotics
ccs01200  Carbon metabolism
Module
ccs_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCNA_03269
   00052 Galactose metabolism
    CCNA_03269
   00500 Starch and sucrose metabolism
    CCNA_03269
   00520 Amino sugar and nucleotide sugar metabolism
    CCNA_03269
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CCNA_03269
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CCNA_03269
Enzymes [BR:ccs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CCNA_03269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-GeneID: 7330863
NCBI-ProteinID: YP_002518642
UniProt: A0A0H3CCQ6
Position
3438397..3439374
Genome map
AA seq 325 aa AA seqDB search
MAKGSVLLADVNGRDLALALVSPGDAPRGHRDLACASLKALEEHLIDAVSEHSADGLIGA
AVCGAGPEIDGAIALTAGDFTLTQAWLRAVLKTPRVSLLNDFAACALGAPRLAPSAMRLI
HEGKPGRNAQIAVIGPNLGLGVAALTPHRTDGWTPVVSEGGHIDFTPGEPREVPVFEALQ
ARHGRVSAEHFLSQQGLADIYAALGGGLDDSDEVILARVRDGDETAREALSIFSALLGAF
AGDAALSFAARGGVYINSPLMERIDGLLDQAAFSRRFEDKGRMSAYLKDIPVYLAVGRCT
LLGLSALFTASDLRYEAAEVKVLDC
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggccaagggatcggtcctgctcgccgacgtgaatggtcgcgatctggccctggcgctg
gtcagtccgggcgacgcgccgcgcggacatcgcgatctagcctgcgcgtcgctcaaagcg
cttgaagagcacctgatcgacgccgtgtccgagcattcggctgacggcctgatcggagcc
gctgtctgcggcgccggccccgaaatcgacggcgcgatcgcgctgacggccggcgacttc
acgctgacccaggcctggttgcgcgcggtgctgaagacgccgcgcgtctcgctgttgaac
gacttcgccgcctgcgccctgggcgcgccccgcctggccccgtcggccatgcgcctgatc
cacgagggcaagcccggccgcaacgcccagatcgccgtgatcggtcccaatctcggtctc
ggcgtcgccgccctgacgccccaccgaaccgacgggtggacgcccgtagtcagcgagggt
gggcatatcgacttcacccccggcgagccccgcgaagtcccggtgttcgaggcgctgcaa
gcccggcacggccgggtctcggcggagcatttcctgtcacagcagggcctcgccgatatc
tatgcggccctgggcggcgggctggacgatagcgacgaggtcatcctcgcccgggtccgg
gacggcgacgagacggcgcgggaagccctgtcgatcttcagcgccctcttgggggccttc
gcgggagacgccgccctcagcttcgcggcccggggaggcgtctatatcaacagccccctg
atggaacgcatcgatggcctgctcgatcaggccgccttcagccggcgctttgaggacaag
ggccggatgagcgcctatctcaaggacatcccggtctatctcgccgtcgggcggtgcacg
ctgctgggcttgtccgcgctcttcaccgccagcgacctgcgatacgaagccgccgaggtg
aaggtcctcgactgctga

DBGET integrated database retrieval system