KEGG   Caulobacter crescentus NA1000: CCNA_03332Help
Entry
CCNA_03332        CDS       T00841                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CCNA_03332
Enzymes [BR:ccs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CCNA_03332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3511434..3512258)
Genome map
AA seq 274 aa AA seqDB search
MSTAFRPRVMGIVNVTPDSFSDGGKFLAAQDGVEHARRLIAQGADILDIGGESTRPGAAP
VSEFDEILRVVPLIEAVRRASDVPVSIDTMKPAVARAAVKAGATMWNDVTALRFSPDAPE
VAAELGCEVVLMHMLGEPGTMQDAPRYDDVVSEVEAFLLARAFTAMAAGVAKDKIWLDPG
IGFGKTLAHNLALIAALPRFVALGYPILLGASRKRFIAGIDSSAHEASDRLGGSIAAHLA
GAEAGVAAVRVHDVRETVQALDVLRAIRGAGSPP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgccttccggccccgggtgatggggatcgtcaacgtcacgcccgacagcttc
tctgacgggggcaagtttctcgcggcgcaggatggtgtcgagcacgcgcgtcgcctgatc
gcccagggcgccgacatcctggacatcggcggcgaaagcacgcgtcccggcgcggcgccc
gtgtccgagtttgacgagatcttgcgggttgttcccctcatcgaagcggtgcgacgcgcc
agcgatgttccggtgtccatcgatacgatgaagccggccgtcgcgcgggccgccgtcaag
gccggggcgacgatgtggaacgacgtcaccgccctgcggttctcgccggacgccccggaa
gtcgccgccgaactgggctgcgaggtggtcttgatgcacatgctgggcgagccgggcacg
atgcaggacgcgccgcgctatgacgacgtcgtgtccgaggtcgaggccttcctgctggcg
cgggcgtttacggccatggccgccggggtggccaaggacaagatctggctcgacccgggc
atcggctttggcaagacgctggcgcacaatctcgcgctgatcgccgccctgccgcggttc
gtcgctctgggctatccgatcctgctgggcgccagccgcaagcggttcatcgccgggatc
gactcttcggcccatgaagcctccgaccgtcttggcggctcgatcgccgcgcatctcgcc
ggcgccgaggcgggcgtggcggccgtgcgggtccatgatgtgcgcgaaaccgtccaggcg
ctggatgtgctgcgggctattcgtggcgccgggtcgcccccttaa

DBGET integrated database retrieval system