KEGG   Caulobacter crescentus NA1000: CCNA_03510Help
Entry
CCNA_03510        CDS       T00841                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
ccs00260  Glycine, serine and threonine metabolism
ccs00750  Vitamin B6 metabolism
ccs01100  Metabolic pathways
ccs01110  Biosynthesis of secondary metabolites
ccs01120  Microbial metabolism in diverse environments
ccs01230  Biosynthesis of amino acids
Module
ccs_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCNA_03510
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CCNA_03510
Enzymes [BR:ccs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CCNA_03510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Abhydrolase_9_N
Motif
Other DBs
NCBI-GeneID: 7332507
NCBI-ProteinID: YP_002518883
UniProt: A0A0H3CCG0
Position
complement(3668362..3669759)
Genome map
AA seq 465 aa AA seqDB search
MRYVSTRGQSAPIGFLDAVLAGLAPDGGLYVPAEWPSFTAKQIAAFAGKPYAEVAAAVVG
KFVGDDIPADDLLQMCEEAYATFAHTAVTPVKQLTANRYLLELFHGPTLAFKDVAMQLLG
RLYDYVLERQSRKMTIICATSGDTGGAAVEAFRGRKNARIVALFPEGRISEVQRRFMTTA
TDANVACVSVLGSFDDCQAIVKQAFQDDQFRHAVDLSGVNSINWARIAAQSVYYFTAAVA
LGAPAREVAFVVPTGNFGDAYAAFVAKTLGLPIHSVTAATNSNDILARAFEDGRYSRGAV
AATQSPAMDIQVASNFERLYFEAVRRDGVETGRAFRAFADTGLLDIPPAAHAWMRELFRG
ASVSEADTAKTMLSTLNETGEVVDPHTAVGLAAAQGVRIDPAIPVVVLSTAHPAKFPEAV
QAATGLLPSTPRATPDLSKKPEKFERLPADGSSVKAFVRTFAANS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacgtttcgacccgcggccagtccgcccccatcggcttcctcgacgccgtcctg
gccggcctggcccccgacggtggcctgtacgtgcccgccgaatggcccagcttcacggcc
aagcagatcgccgccttcgccggcaagccctatgccgaggtcgccgccgccgtggtcggc
aagttcgtgggcgacgacattcccgccgacgacttgctccagatgtgcgaggaggcctac
gccaccttcgcccacaccgctgtgacgccggtaaagcaactgactgccaaccgctatctg
ctggaactgttccacggaccgaccctggcgttcaaagatgttgcgatgcagctcttgggc
cgcctctacgactacgtgctcgagcgccagtcgcggaagatgaccatcatctgcgccact
tcgggcgataccggcggcgcggccgtcgaagcgttccggggccgcaagaacgcccgcatc
gtcgcgctcttccccgagggccgcatcagcgaggtgcagcgccggttcatgaccaccgcg
accgacgccaatgtcgcctgcgtctcggtgctgggttcgttcgacgactgccaggccatc
gtcaagcaggccttccaggacgaccagttccgccacgcggtggacctgtcgggcgtcaac
tcgatcaactgggcgcggatcgcggcccagagcgtctattacttcaccgccgccgtggcc
ctgggcgccccggcgcgcgaagtggccttcgtggtgccgaccggcaatttcggcgacgcc
tacgccgccttcgtggccaagacgctgggcctgccgatccattcggtgaccgccgccacc
aacagcaacgacatcctggcccgcgccttcgaggacggccgctattcgcgcggcgcggtg
gccgccacccagagcccggccatggacatccaggtcgcgtcgaacttcgagcgtctctat
ttcgaggccgtgcgtcgcgacggggtcgagaccggccgcgccttccgcgcgttcgccgac
accggcctgctggacatcccgcccgccgcccatgcctggatgcgcgagctgttccgcggc
gcgtcagtcagcgaggccgacaccgccaagaccatgctctcgacgctgaacgagaccggc
gaggtcgtcgatccgcacacggctgtcggcctggccgccgcccagggcgtccggatcgat
ccggccatcccggtcgtggtgctgtcgaccgcccatccggccaagttcccagaggcggtt
caggccgccacgggcctgctgccctcgaccccgcgcgctacgcccgacctctccaagaag
ccggaaaagttcgagcgtctgcccgcggatggatcgtcggtgaaggcctttgtgcggacc
ttcgcggcgaatagttga

DBGET integrated database retrieval system