KEGG   Caulobacter crescentus NA1000: CCNA_03582Help
Entry
CCNA_03582        CDS       T00841                                 

Definition
3'(2'),5'-bisphosphate nucleotidase CysQ (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CCNA_03582
Enzymes [BR:ccs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CCNA_03582
Transfer RNA biogenesis [BR:ccs03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CCNA_03582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3738874..3739671)
Genome map
AA seq 265 aa AA seqDB search
MSDDKRTVQDLADWGRTLAKITEEAAVVILPFWRTELAVAQKADESPVTEADRAGERLIL
ERLAALYPAIPVISEEDASEFGTPESVGPRFFLVDPVDGTKAFVRGDPNFTVNIGLIEHG
VPVAGAVCAPATGEVWFTTADGAAKRAGPDAAEAPIRVRPWPTGQALGLISHTMREEKAT
ELAAEYGFDLRTPMDSSIKMCRIAEGSADIYPRHGPTSEWDTAAGHAVLVAAGGAFTQPD
GSPFLYGKADQSFRNGWFVARGGRP
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgataagcggacggttcaagatctcgcggactggggcaggaccctcgccaag
atcaccgaggaggccgccgtggtcatcctgccgttctggcgcaccgaactggccgtcgcc
cagaaggccgacgagagcccggtgaccgaggccgatcgcgccggcgagcgcctgatcctg
gagcgcctggcggcgctctaccccgctatcccggtgatctcggaagaagacgccagcgag
ttcggtacgcccgagtccgtcggaccgcgtttctttctggttgatccggtcgacggcact
aaggccttcgtgcgcggcgatccgaacttcacggtcaatatcggcctgattgagcacggc
gttccggtcgcgggcgcggtctgcgccccggccaccggcgaggtgtggttcaccacggct
gacggcgccgccaagcgcgctggacccgacgcggctgaggcgccgatccgggttcgtccc
tggccgaccggtcaggcgctgggcctgatcagccacaccatgcgcgaggaaaaggccacg
gagttggccgccgagtacggctttgacctgcgcacgccgatggacagctcaatcaagatg
tgccggatcgccgaaggctcggccgacatctatccgcgccacggcccgacctcggagtgg
gacaccgccgccggccacgccgtgctggtcgccgcgggcggcgccttcacccagcccgac
ggttcgccgttcctctatggcaaggccgaccagagcttccgcaacggctggttcgtcgca
cgcggcggacgaccctag

DBGET integrated database retrieval system