KEGG   Caulobacter crescentus NA1000: CCNA_03582Help
Entry
CCNA_03582        CDS       T00841                                 

Definition
3'(2'),5'-bisphosphate nucleotidase CysQ (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ccs00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3738874..3739671)
Genome map
AA seq 265 aa AA seqDB search
MSDDKRTVQDLADWGRTLAKITEEAAVVILPFWRTELAVAQKADESPVTEADRAGERLIL
ERLAALYPAIPVISEEDASEFGTPESVGPRFFLVDPVDGTKAFVRGDPNFTVNIGLIEHG
VPVAGAVCAPATGEVWFTTADGAAKRAGPDAAEAPIRVRPWPTGQALGLISHTMREEKAT
ELAAEYGFDLRTPMDSSIKMCRIAEGSADIYPRHGPTSEWDTAAGHAVLVAAGGAFTQPD
GSPFLYGKADQSFRNGWFVARGGRP
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgataagcggacggttcaagatctcgcggactggggcaggaccctcgccaag
atcaccgaggaggccgccgtggtcatcctgccgttctggcgcaccgaactggccgtcgcc
cagaaggccgacgagagcccggtgaccgaggccgatcgcgccggcgagcgcctgatcctg
gagcgcctggcggcgctctaccccgctatcccggtgatctcggaagaagacgccagcgag
ttcggtacgcccgagtccgtcggaccgcgtttctttctggttgatccggtcgacggcact
aaggccttcgtgcgcggcgatccgaacttcacggtcaatatcggcctgattgagcacggc
gttccggtcgcgggcgcggtctgcgccccggccaccggcgaggtgtggttcaccacggct
gacggcgccgccaagcgcgctggacccgacgcggctgaggcgccgatccgggttcgtccc
tggccgaccggtcaggcgctgggcctgatcagccacaccatgcgcgaggaaaaggccacg
gagttggccgccgagtacggctttgacctgcgcacgccgatggacagctcaatcaagatg
tgccggatcgccgaaggctcggccgacatctatccgcgccacggcccgacctcggagtgg
gacaccgccgccggccacgccgtgctggtcgccgcgggcggcgccttcacccagcccgac
ggttcgccgttcctctatggcaaggccgaccagagcttccgcaacggctggttcgtcgca
cgcggcggacgaccctag

DBGET integrated database retrieval system