KEGG   Caulobacter crescentus NA1000: CCNA_03643Help
Entry
CCNA_03643        CDS       T00841                                 

Definition
succinate dehydrogenase membrane anchor subunit (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCNA_03643
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCNA_03643
   00650 Butanoate metabolism
    CCNA_03643
  Energy metabolism
   00190 Oxidative phosphorylation
    CCNA_03643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3802816..3803271)
Genome map
AA seq 151 aa AA seqDB search
MGHRRRHRSVLIMSKKDLFQPQQFRTPLSRARGMGASRHGVSHFITERVSGLALAPLTVW
GAYAALKQVRAPHDVVVQWMAQPVNAVLLSLLLIAALVHLQSAVQVVIEDYIERFTTKTA
LVIGNLFVCVLAGAVGVFSILKVALTVTGAH
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgggtcatcgccggcggcatcggagcgttctgatcatgagcaagaaagacctctttcag
ccccagcagttccgcacgccgctatcgcgcgctcgcggtatgggcgcctcgcgtcacggc
gtcagccacttcatcaccgagcgggtttcgggcctggccctggcgccgctgacggtgtgg
ggcgcctacgccgcgctcaagcaggtgcgcgcgccgcatgacgtggtcgtccagtggatg
gcccagcccgtcaacgccgtgcttttgagcctgctgctgatcgccgccctcgtgcacctg
caaagcgcggtgcaggtggtgatcgaagactatatcgagcgcttcacgaccaagaccgcc
ctggtgatcggcaacctgttcgtctgcgtgctggccggcgccgtaggggtcttctcgatc
ctcaaggtcgccctgaccgtgaccggagcccattga

DBGET integrated database retrieval system