KEGG   Caulobacter crescentus NA1000: CCNA_03657Help
Entry
CCNA_03657        CDS       T00841                                 

Definition
(RefSeq) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CCNA_03657
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCNA_03657
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCNA_03657
Enzymes [BR:ccs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CCNA_03657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(3818431..3819258)
Genome map
AA seq 275 aa AA seqDB search
MTKDRIDRRFAALKAENRAGFVTYVMAGDPDAATTLSVLKGLPAAGADLIELGFPFSDPM
AEGPTIQRAAQRGLKSGMTLQGTLDLVAAFREGDQDTPIILMGYLNPVLNKGFETFAALA
AKAGVDGLIIVDCPPEEADPLSDALEAEGIALIRLAAPTTDDARLPMVVRRTSGFVYYVS
VAGVTGVKSADAADVAPAVERLRKASGLPVAVGFGIRTPDQAAAVAKVADAAVVGSALVD
EIESAAQLNENVTEKVLLKASELAKAVRSARVGTK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaagaccgtatcgatcgccgctttgcggcgctgaaggccgaaaaccgcgccggc
ttcgtgacctatgtcatggccggcgaccctgacgccgccacgacgctgtccgtgctcaag
ggcctgcccgccgccggcgcggatctgatcgagctgggctttccgttctctgatccgatg
gctgagggcccgaccatccagcgcgccgcccagcggggcctgaagtccggcatgaccctg
cagggcacgctggatctggtggccgccttccgcgaaggcgaccaggacacgccgatcatc
ctgatgggctatctgaacccggttctgaacaagggctttgagaccttcgcagcgctggcc
gccaaggccggggtcgacggcctgatcatcgtcgactgcccgcccgaagaggccgacccg
ctgtcggacgcgctggaagccgagggcatcgccctgattcgtctcgcggccccgaccacc
gatgacgcccgcctgccgatggtggtgcgccgcacctcgggcttcgtctattacgtctcg
gtcgccggggtgaccggagtgaagtcggccgacgcggccgatgtggcccccgccgtcgag
cgcctgcgcaaggcctcgggcctgccggtcgccgtgggctttggtatccgcacgccggac
caggccgccgccgtcgccaaggtggcggacgcggccgtcgtcggctcggccctggtcgat
gaaatcgagtcggcggcgcagttgaacgaaaacgtgaccgagaaggttcttctaaaagcg
tcggagctggctaaggctgtgcgctcggcgcgagtcgggacgaagtga

DBGET integrated database retrieval system