KEGG   Caulobacter crescentus NA1000: CCNA_03657Help
Entry
CCNA_03657        CDS       T00841                                 

Definition
(RefSeq) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
ccs00260  Glycine, serine and threonine metabolism
ccs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccs01100  Metabolic pathways
ccs01110  Biosynthesis of secondary metabolites
ccs01130  Biosynthesis of antibiotics
ccs01230  Biosynthesis of amino acids
Module
ccs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCNA_03657
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCNA_03657
Enzymes [BR:ccs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CCNA_03657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-GeneID: 7329748
NCBI-ProteinID: YP_002519030
UniProt: B8H661
Position
complement(3818431..3819258)
Genome map
AA seq 275 aa AA seqDB search
MTKDRIDRRFAALKAENRAGFVTYVMAGDPDAATTLSVLKGLPAAGADLIELGFPFSDPM
AEGPTIQRAAQRGLKSGMTLQGTLDLVAAFREGDQDTPIILMGYLNPVLNKGFETFAALA
AKAGVDGLIIVDCPPEEADPLSDALEAEGIALIRLAAPTTDDARLPMVVRRTSGFVYYVS
VAGVTGVKSADAADVAPAVERLRKASGLPVAVGFGIRTPDQAAAVAKVADAAVVGSALVD
EIESAAQLNENVTEKVLLKASELAKAVRSARVGTK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaagaccgtatcgatcgccgctttgcggcgctgaaggccgaaaaccgcgccggc
ttcgtgacctatgtcatggccggcgaccctgacgccgccacgacgctgtccgtgctcaag
ggcctgcccgccgccggcgcggatctgatcgagctgggctttccgttctctgatccgatg
gctgagggcccgaccatccagcgcgccgcccagcggggcctgaagtccggcatgaccctg
cagggcacgctggatctggtggccgccttccgcgaaggcgaccaggacacgccgatcatc
ctgatgggctatctgaacccggttctgaacaagggctttgagaccttcgcagcgctggcc
gccaaggccggggtcgacggcctgatcatcgtcgactgcccgcccgaagaggccgacccg
ctgtcggacgcgctggaagccgagggcatcgccctgattcgtctcgcggccccgaccacc
gatgacgcccgcctgccgatggtggtgcgccgcacctcgggcttcgtctattacgtctcg
gtcgccggggtgaccggagtgaagtcggccgacgcggccgatgtggcccccgccgtcgag
cgcctgcgcaaggcctcgggcctgccggtcgccgtgggctttggtatccgcacgccggac
caggccgccgccgtcgccaaggtggcggacgcggccgtcgtcggctcggccctggtcgat
gaaatcgagtcggcggcgcagttgaacgaaaacgtgaccgagaaggttcttctaaaagcg
tcggagctggctaaggctgtgcgctcggcgcgagtcgggacgaagtga

DBGET integrated database retrieval system