KEGG   Caulobacter crescentus NA1000: CCNA_03658Help
Entry
CCNA_03658        CDS       T00841                                 

Definition
(RefSeq) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
ccs00260  Glycine, serine and threonine metabolism
ccs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccs01100  Metabolic pathways
ccs01110  Biosynthesis of secondary metabolites
ccs01130  Biosynthesis of antibiotics
ccs01230  Biosynthesis of amino acids
Module
ccs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCNA_03658
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCNA_03658
Enzymes [BR:ccs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CCNA_03658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 7329749
NCBI-ProteinID: YP_002519031
UniProt: A0A0H3CFJ6
Position
complement(3819271..3820491)
Genome map
AA seq 406 aa AA seqDB search
MNAPAKPNDYSAYPDAEGRFGGFGGRYVAETLMPLVLDLGKAYADAKADPEFQAQLKSYN
THYAGRPSPLYFAERLTEHFGGAKIYFKRDELNHTGSHKINNALGQILLAMRMGKTRIIA
ETGAGQHGVATATVCARFGLPCVVYMGATDVERQKPNVFRMNLLGAEVRPVSSGTGTLKD
AMNEAMRDWVTNVHDTYYLIGTAAGPHPYPVMVRDFQSVIGAEAREQILEMEGRLPDAVV
ACIGGGSNAIGLFHPFLGDEGVRLIGVEAAGHGVSTDKHAASLTGGRPGVLHGNRTYLLQ
DDDGQIIDAHSISAGLDYPGIGPEHSFLHDIGRAEYVSTTDTEALEAFKLCSTLEGIIPA
LEPAHALARVGEIAQELGKGKIVVMNLCGRGDKDIFTVAEALGRKI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgctcctgcgaaacccaatgactactcggcctatcccgatgcggagggccgcttt
ggcgggttcggcggccgctatgtcgccgagaccctgatgccgctggtcctggacctgggc
aaggcctatgccgacgccaaggccgatccggaattccaggcgcagctgaaaagctacaac
acccattacgctggccggccgagcccgctctatttcgccgagcgcctgaccgagcacttc
ggcggggccaagatctatttcaagcgcgacgagctgaatcacaccggctcgcacaagatc
aacaacgccctgggccagatccttctggccatgcgcatgggcaagacccggatcatcgcc
gagaccggcgctggccagcacggcgtggccaccgccaccgtctgcgcccgctttggcctg
ccctgcgtggtctatatgggcgccaccgacgtcgagcggcagaagcccaatgtcttccgc
atgaacctgctgggcgcggaagttcgccccgtcagctcgggcaccggcaccctgaaggac
gccatgaacgaagcgatgcgcgattgggtgaccaacgtgcatgacacctattacctgatc
ggcacggccgccggcccgcacccctatccggtgatggtccgtgacttccagagcgtgatc
ggcgccgaagcgcgtgagcagatcctcgaaatggaaggccgactgcccgacgcggtggtc
gcctgcatcggcggcggctccaacgccatcggcctcttccacccgttcctcggcgacgag
ggtgtgcgcctgatcggcgtcgaggcggccggccacggcgtctccaccgacaagcacgcc
gcctcgctgaccggcggccgtcctggcgtgctgcacggcaaccgcacctacctgctgcag
gacgacgacggccagatcatcgacgctcactcgatctcggctggcctcgactatccgggc
atcggccccgagcactcgttcctgcacgacatcggccgcgccgaatatgtctcgaccacg
gacaccgaggccttggaggccttcaaactgtgctcgacgctggaaggcatcatcccggcc
ctggagccggcccacgccctggcccgggtcggcgagatcgcccaggagctgggcaagggc
aagatcgtggtgatgaatctctgcggtcgcggcgacaaggacatcttcacggtggccgaa
gccctcgggcgcaagatctag

DBGET integrated database retrieval system