KEGG   Caulobacter crescentus NA1000: CCNA_03748Help
Entry
CCNA_03748        CDS       T00841                                 

Definition
(RefSeq) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
ccs00521  Streptomycin biosynthesis
ccs00523  Polyketide sugar unit biosynthesis
ccs01130  Biosynthesis of antibiotics
Module
ccs_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CCNA_03748
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CCNA_03748
Enzymes [BR:ccs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     CCNA_03748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-GeneID: 7331944
NCBI-ProteinID: YP_002519121
UniProt: A0A0H3CD10
Position
3918154..3918711
Genome map
AA seq 185 aa AA seqDB search
MKITPLAIPEVLLITPARHGDERGWFSETFRQSALEEAGFQAAFVQDNHVRSTTRGIQRG
LHYQKPPHAQDKLLRCVVGSIFDVAVDIRKGSPTFGHWVGAELSAENRQQLLVPKGFAHG
YVTLSDACEVLYKVTDYYAPQAEGGVRWSDPAIGIEWPIPLNEITANDRDNAAPLLAEIE
TPFAY
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcacgccgttggcgatccccgaagtgctgcttatcacgcccgcgcgccatggc
gatgagcgcggctggttttccgagacgttccggcaatcggcgctggaggaggccggattc
caggccgccttcgtccaggacaatcacgtgcgttcgacgacacgcggcatccagcgcggc
ctgcactaccagaagccgccgcacgcccaggacaagctgctgcgctgcgtggtgggatcg
atcttcgacgtcgcagtcgacatccgcaaaggctcgccgaccttcggccactgggtcggg
gccgagctgtcggccgagaatcggcagcaactgctggtgcccaagggcttcgcccacggt
tatgtcaccctgagcgacgcctgcgaggtgctctacaaggtcaccgactactacgcgccc
caggccgagggcggcgtacgctggagcgatccggccatcgggatcgaatggccgataccg
ttgaacgagatcacggccaatgatcgcgacaacgccgccccgctgctggcggagatcgag
acgcctttcgcgtactga

DBGET integrated database retrieval system