KEGG   Caulobacter crescentus NA1000: CCNA_03752Help
Entry
CCNA_03752        CDS       T00841                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CCNA_03752
   00052 Galactose metabolism
    CCNA_03752
   00500 Starch and sucrose metabolism
    CCNA_03752
   00520 Amino sugar and nucleotide sugar metabolism
    CCNA_03752
Enzymes [BR:ccs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CCNA_03752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3921686..3922582
Genome map
AA seq 298 aa AA seqDB search
MSADEMSMKPVRKAVLPVAGLGTRVLPGTKTTPKELLNVVDRPILSYIVEEGRKAGIEHF
VFVTGRSKGAIEDYFDHQIELEAQLEAKGKIEILEQLRAELPKPGEMSFVRQMAPLGLGH
AVWCARDIIGDEPFAVMLPDVIVDAERACLGQLIDLYNKVGGGNVIGVEEVPESETHKYG
VVAPGKVDGRMATMTGMVEKPAKGTAPSNWAIAGRYILQPEIFALLAAQEKGAGNEIQLT
DSMAKLMQDQAFHAYVYEGVTHDCGDKIGLLRANVALALKRADLGAAARAAVEAALKA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcagacgagatgtccatgaaacccgttcgcaaagctgttcttccggtcgccggt
ctcggtacgcgtgtcctgccgggcaccaagaccacgccaaaggaactgctgaacgtcgtc
gatcgaccaattctttcctacattgtcgaggaaggtcgcaaggcgggcatcgaacacttc
gtcttcgtcaccggccgctcgaagggcgcgatcgaggactatttcgatcatcagatcgag
cttgaggcgcagctggaagccaagggcaagatcgagatccttgaacagctgcgcgccgag
ttgcccaagcccggcgagatgagcttcgtgcgccagatggcccccctgggcctgggccac
gccgtctggtgcgcccgtgacatcatcggcgacgagcccttcgcggtcatgctgccggac
gtcatcgtcgacgccgagcgcgcctgcctcggccaactgatcgacctctacaacaaggtc
ggcggcggcaatgtcatcggcgtcgaggaagtgccggaaagcgagacccacaagtacggc
gtcgttgcgcccggcaaggtcgatggccgcatggcgaccatgaccggcatggtcgagaag
ccggcgaagggcacggcgccgtccaactgggcgatcgccggccgctatatcctgcagccc
gagatcttcgccctgctggccgctcaggagaagggcgccggcaacgagatccagctgacc
gattcgatggccaagctgatgcaggaccaggccttccacgcctatgtctatgagggcgtc
acccacgactgcggcgacaagatcggcctgctacgcgccaatgtggccctggccttgaag
cgcgccgacctgggcgccgccgcccgcgcggcggtcgaggcggcgctgaaggcctaa

DBGET integrated database retrieval system