KEGG   Caulobacter crescentus NA1000: CCNA_03752Help
Entry
CCNA_03752        CDS       T00841                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
ccs00040  Pentose and glucuronate interconversions
ccs00052  Galactose metabolism
ccs00500  Starch and sucrose metabolism
ccs00520  Amino sugar and nucleotide sugar metabolism
ccs01100  Metabolic pathways
ccs01130  Biosynthesis of antibiotics
Module
ccs_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CCNA_03752
   00052 Galactose metabolism
    CCNA_03752
   00500 Starch and sucrose metabolism
    CCNA_03752
   00520 Amino sugar and nucleotide sugar metabolism
    CCNA_03752
Enzymes [BR:ccs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CCNA_03752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CoA_transf_3
Motif
Other DBs
NCBI-GeneID: 7331948
NCBI-ProteinID: YP_002519125
UniProt: A0A0H3CCD6
Position
3921686..3922582
Genome map
AA seq 298 aa AA seqDB search
MSADEMSMKPVRKAVLPVAGLGTRVLPGTKTTPKELLNVVDRPILSYIVEEGRKAGIEHF
VFVTGRSKGAIEDYFDHQIELEAQLEAKGKIEILEQLRAELPKPGEMSFVRQMAPLGLGH
AVWCARDIIGDEPFAVMLPDVIVDAERACLGQLIDLYNKVGGGNVIGVEEVPESETHKYG
VVAPGKVDGRMATMTGMVEKPAKGTAPSNWAIAGRYILQPEIFALLAAQEKGAGNEIQLT
DSMAKLMQDQAFHAYVYEGVTHDCGDKIGLLRANVALALKRADLGAAARAAVEAALKA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcagacgagatgtccatgaaacccgttcgcaaagctgttcttccggtcgccggt
ctcggtacgcgtgtcctgccgggcaccaagaccacgccaaaggaactgctgaacgtcgtc
gatcgaccaattctttcctacattgtcgaggaaggtcgcaaggcgggcatcgaacacttc
gtcttcgtcaccggccgctcgaagggcgcgatcgaggactatttcgatcatcagatcgag
cttgaggcgcagctggaagccaagggcaagatcgagatccttgaacagctgcgcgccgag
ttgcccaagcccggcgagatgagcttcgtgcgccagatggcccccctgggcctgggccac
gccgtctggtgcgcccgtgacatcatcggcgacgagcccttcgcggtcatgctgccggac
gtcatcgtcgacgccgagcgcgcctgcctcggccaactgatcgacctctacaacaaggtc
ggcggcggcaatgtcatcggcgtcgaggaagtgccggaaagcgagacccacaagtacggc
gtcgttgcgcccggcaaggtcgatggccgcatggcgaccatgaccggcatggtcgagaag
ccggcgaagggcacggcgccgtccaactgggcgatcgccggccgctatatcctgcagccc
gagatcttcgccctgctggccgctcaggagaagggcgccggcaacgagatccagctgacc
gattcgatggccaagctgatgcaggaccaggccttccacgcctatgtctatgagggcgtc
acccacgactgcggcgacaagatcggcctgctacgcgccaatgtggccctggccttgaag
cgcgccgacctgggcgccgccgcccgcgcggcggtcgaggcggcgctgaaggcctaa

DBGET integrated database retrieval system