KEGG   Coprococcus catus: CC1_04030Help
Entry
CC1_04030         CDS       T02584                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cct  Coprococcus catus
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cct00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CC1_04030
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CC1_04030
Enzymes [BR:cct01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     CC1_04030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
425764..426363
Genome map
AA seq 199 aa AA seqDB search
MGQIKVEKNVGGIEGLCVIEPAVHGDARGYFMETYSQRDMEENGIHIQFVQDNQSMSTKG
VLRGLHFQKNYPQTKLVRVIKGSVFDVAVDLRSGSETYGKWYGIELTEENKKQFLIPRGF
AHGFLVLSDTAEFCYKCDDFYHPNDEGGMAWNDPEIGIEWPKVKGEYRGNADAEGYTLED
GTALNLSDKDQKWLGLKDR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgggacagatcaaggttgagaaaaatgtcggcggtattgaaggactctgtgtcattgaa
ccggcggttcatggtgatgctcgcggatatttcatggagacatatagtcagagagatatg
gaggaaaatggcatccatattcaatttgtgcaggataatcaatccatgtcgaccaagggg
gttcttcgtggtttacattttcagaagaattatccacagaccaaattagttcgagtgatt
aaaggatccgtatttgatgtggcagtggatcttcgaagcggaagtgagacctatggaaag
tggtatggcattgaactgacagaagagaataagaaacagtttcttattccgagaggtttt
gcccatggtttccttgtgctcagtgacacagcagaattctgctacaagtgcgatgatttt
tatcatccgaatgacgaaggcggtatggcctggaatgatccggagattggtattgaatgg
ccgaaggtgaaaggcgaatacagaggcaatgcagatgcagagggatatacattagaagat
ggtactgcattgaatctgagtgataaagaccagaaatggttaggactaaaagatagatga

DBGET integrated database retrieval system