KEGG   Coprococcus catus: CC1_11950Help
Entry
CC1_11950         CDS       T02584                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cct  Coprococcus catus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cct00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CC1_11950
Enzymes [BR:cct01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CC1_11950
Exosome [BR:cct04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CC1_11950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1236907..1238901
Genome map
AA seq 664 aa AA seqDB search
MALEHRISELDTYLFAKGTHYEIYEKMGAHLAEEDGKAGTYFSVWAPNARSVSVVGDFNN
WDRSAHPMQPVQQSGIWDIFVPGVKAGDLYKFAVETSQGYTVLKADPYGNQSQLRPDNAS
VVADIRHFDWTDQAWRKAHQEKKTESPMAIYEVHPGSWKKDPSMPGEFYNFKKLAVELAD
YVLEMGYTHVELIGLSEHPFDGSWGYQVSGYYAPTARYGTPADFMYFVNYMHDHGIGVIL
DWVPAHFPKDEFGLGRFDGTALYEHQDPRKGEHPEWGTYCFNYGRTEVSNFLVANALFWI
EKFHVDGLRVDAVASMLYLDFGRSSGNWIPNEDGGNQNYEAITFLKHLNSIVAQRNPGAM
MIAEESTAWPKVTGDVDDGGLGFTYKWNMGWMHDFLEYMKCDPIFRKYHQNQITFSFMYA
YSENYVLVLSHDEVVHLKKSMIYKMPGTMPEKFGNLRAAYGLMMMHPGKKLLFMGQDFAQ
TAEWNEAKSLDWHLLEKYPEHQQLNHYYCDLLHFYQNEPALYELDDSPEGFAWINGSDAE
HNMLTFCRMTKDKKNCLLCHFNFSPVAYENFQSGVLCPGTYTEVFNSNAAEYGGTGLVNS
EPIEAVKESWDFKDYSIKYHLGAYGVCIFKFDYVEPKPEEPQKPARRYTKEDIHKLAGHY
KKIK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggctttagaacacagaatttcagaattggacacctatttatttgcaaaggggacacat
tatgagatttatgagaagatgggggcgcatctggctgaagaagatggcaaagcgggcacc
tatttctctgtatgggcaccgaatgcaagaagtgtcagtgtggtaggcgattttaataac
tgggacagatcggcgcatccgatgcagccggttcagcagtccggaatatgggatatcttt
gttccgggggtgaaggcaggagatttatataagtttgcggtggagaccagccagggctat
acggttttgaaagcggatccttatggcaatcagtcacagctgcgtccggataatgcatct
gttgttgcagatatacgacattttgactggacggatcaggcatggcggaaggcgcatcag
gagaagaagacagaatcaccaatggcaatttacgaagtgcatccgggttcatggaagaaa
gatccttccatgccgggagaattttataattttaagaagttggcggtggagctggcagat
tatgttctggaaatgggttatacgcatgtggagctgatcggtctttctgagcatcctttt
gatggttcctggggctatcaggtatccggctactatgctccgacagccagatacggtaca
ccggcggatttcatgtattttgtgaattatatgcatgatcatggcattggcgttattctg
gactgggtaccggcacattttccgaaggatgagtttggactgggacgttttgacggtaca
gcactgtatgaacaccaggatccgagaaagggagaacatccggaatggggcacctattgt
tttaattacggcagaacagaggtttccaatttccttgtggccaatgcattattctggatt
gagaagttccatgtggatggtctgcgtgtggacgcagtggcttccatgctgtatcttgat
tttggtcgttcttccggcaactggattccgaatgaggatggcggcaatcagaactatgag
gccattactttcctgaaacatctgaattctattgtggcacagagaaatccgggggctatg
atgatcgcggaagaatctacagcctggccgaaggtaactggagatgtggatgacggcggt
cttggctttacttataaatggaacatgggatggatgcacgatttccttgagtatatgaag
tgcgatccgattttccgtaagtaccatcagaatcagatcacattcagctttatgtatgct
tacagcgagaattatgtgctggtgctttcgcatgacgaagttgtgcatttgaagaaatct
atgatttacaagatgccgggaacaatgccggagaagttcggcaatctcagagcagcctat
ggtctgatgatgatgcatccgggcaagaaactgctgtttatgggacaggattttgcccag
acagcggaatggaatgaggctaagagcctggactggcatttgcttgagaaatatccggag
catcagcagctgaaccattactattgtgatttgctgcatttctatcagaatgagccggct
ttgtatgaactggatgattcaccggaaggttttgcatggattaacggttctgatgcggag
cacaatatgctgacattctgccgtatgaccaaggataagaagaactgtttgttatgtcat
ttcaatttttcaccggtggcttatgagaattttcagtccggtgtactgtgtccgggaacc
tatacagaggtctttaacagcaatgctgcagaatacggcggcacaggtctggtgaattcg
gaaccgattgaagctgtgaaggaaagctgggatttcaaggactactctattaaatatcat
ctgggtgcttatggtgtatgtattttcaagtttgattatgtagaacctaagccggaagaa
ccacagaaaccggcgagacgctataccaaagaagatattcacaaattggccggtcattat
aagaaaataaaatag

DBGET integrated database retrieval system