KEGG   Coprococcus catus: CC1_12760Help
Entry
CC1_12760         CDS       T02584                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cct  Coprococcus catus
Pathway
cct00500  Starch and sucrose metabolism
cct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cct00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CC1_12760
Enzymes [BR:cct01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CC1_12760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: CBK80077
UniProt: D4J6V6
Position
complement(1316223..1317764)
Genome map
AA seq 513 aa AA seqDB search
MNVQEIKKTPRPRYCGILVHPTSFPSPYGIGDLGDGAYAFIDFLYDAGQTLWQCLPLGPT
GFGDSPYQAFSAFAGQPLLISPDLLLKDGLLEKDDLADVPDFNDYSVEYGNVITYKTALL
RKACAHFTASEDKALHKAFNHFCRTERDWLEDYALFMSLKDLHQGRSWHEWSPQYQVLDT
RTRKAALTELADSITYYQFIQFIFFKQWHELKLYANKKGISVIGDIPIFVSPDSADVWAN
QPLFKLDSKGFPTAVAGVPPDYFSKTGQLWGNPLYNWTEHKKTGYAWWISRIRQQLQLVD
YLRIDHFRGFEAYWSVPYGDETAINGKWIKGPGASLFRAIEKELGKDLPIFAEDLGVITP
QVEKLRDTFHFPGMKVLQFAFNDTAESDFLPYLYPENCICYTGTHDNDTTVGWYLELDEK
YRDKVRRYMNCDGSNIHWDFIRTALGSTARYAIFPLQDLFGFGSDCRMNTPGAAAGNWAW
RYTADRLSPELAEALKTISEVYGRDRARMEVHA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttcaggaaataaaaaaaacaccgcgtccacgctactgcggtatccttgttcac
ccgacttctttcccgagcccttatggaatcggtgatctcggtgatggtgcctatgctttt
atcgactttttatatgacgccggacagaccctctggcagtgtctgccccttggtccgaca
ggtttcggcgattcaccctatcaggctttttcagcctttgccggtcaaccgctgctcatc
agcccggatctgctgctgaaggacggtcttcttgagaaggatgacctggccgatgtaccg
gatttcaacgattattctgttgaatacggcaatgtgatcacttataagactgctctgctc
cgcaaagcctgtgcacattttactgcgtcggaggacaaagccctgcataaagctttcaac
cacttctgccgaaccgagagggattggctggaagactatgctctgtttatgtctctcaaa
gatctgcatcagggccgttcctggcatgaatggtcgcctcagtatcaggttctggatacc
agaacccgaaaggccgcactgaccgaactggccgacagcatcacttactatcagtttatt
cagtttattttcttcaaacagtggcatgaactgaaactttatgccaacaagaaggggatc
tctgtcatcggtgatattccaatctttgtttcaccggacagtgccgatgtctgggcgaac
cagcctctgttcaagcttgacagcaaaggcttcccgacagccgttgccggtgtaccgccg
gattatttttcaaaaaccggtcagctgtggggcaatccgctctacaattggacagaacac
aagaaaaccggatatgcatggtggatctcccgtatccgtcagcagctgcagcttgtagac
tatctgcgtattgatcatttccgtggttttgaagcttactggtccgtaccgtacggcgat
gaaacagctatcaacggcaaatggatcaagggcccgggagcttctcttttccgtgcaatt
gagaaggaactcggcaaagacctgccgatttttgcagaagatctcggtgtgatcaccccg
caggttgaaaagctccgtgataccttccatttcccgggtatgaaggtgcttcagtttgcc
ttcaatgacaccgcagaaagcgattttctgccttatctctaccctgaaaactgcatctgc
tacacaggtacccatgacaatgatacaacggttggttggtatcttgaactggatgagaaa
taccgtgacaaggtccgccgctatatgaactgtgacggcagcaacatccactgggatttc
atccgcacagcccttggctccactgcacgctacgcgatcttcccactccaggatctcttc
ggtttcggaagcgactgccgtatgaatacaccgggtgctgctgcaggcaactgggcatgg
cgctacacagcagacagactctcaccggaactggcagaagcactgaagaccatcagcgaa
gtttacggccgtgaccgcgcacgtatggaggtccacgcatga

DBGET integrated database retrieval system