KEGG   Coprococcus catus: CC1_25500Help
Entry
CC1_25500         CDS       T02584                                 

Definition
NAD-dependent aldehyde dehydrogenases
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cct  Coprococcus catus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cct00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CC1_25500
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CC1_25500
   00620 Pyruvate metabolism
    CC1_25500
   00650 Butanoate metabolism
    CC1_25500
  Lipid metabolism
   00071 Fatty acid degradation
    CC1_25500
  Amino acid metabolism
   00350 Tyrosine metabolism
    CC1_25500
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CC1_25500
   00626 Naphthalene degradation
    CC1_25500
Enzymes [BR:cct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CC1_25500
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CC1_25500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2592566..2595121)
Genome map
AA seq 851 aa AA seqDB search
MTDFLYPDILNEQLTYARQARAAWLWTNVAERSRIFLQVLDTLQPICASLARDSVQETGY
GIFEDRMLMITRLLRDLRSCCLQTESPFSERLSCTDTHTQSQPSGTLLGIPSSIHPVTET
LFAAAIAIQTGNPLIFFFSDSAFQISARTASLIRDAAIAAGAPDNCIQWLEIADDNLLEK
CNHCPDISGLILSGLSANIRKVFSAFSAECILSFPQPAFCYIHYSADPTLAARQIVLSKT
FDNGMCLNGEQIICADAVILPPLKDALRRTGGYFASPEEIVRLTAILANLSDNTVNPSVI
GQSAQALADLAGIVIPESTRLIILEIEPDNASHPLLLPFLCPVLVLISVNDYEQAADKIR
LLSTKSASFSTDFPFSDTRPLPTHHYLALYAADNAPISFLSYALPDFSIIENAPAASVSM
IQQYMDIYGHLLPSSAIPQLFSIRRCHSTMIETARCFSFPAEIYYGQNPLEQLKLYEHED
HLLFLQCPAFSESAVQTVIKRIQQKYPFIQYECLKLAPDDSQITDFLCQHSLFPELPAAP
DCLIVIGDSTAVHIAKMLMTRYQQSASSSLPRLIIMTSDAGCHAALLPFYPHYDSCSNRL
TDMSCRLSYFTLIADSHFSFFRSHKHLISASMAAMADAFDSLLFVGGDDISDAMAFRSIQ
LFLVWLPLFLSAPSERGHQKNRPDACLEHLQNACILSGLACSHTGLGLSHILSQQLCCEF
RISMSALQALLIPRLLLYYGSDSTHLSGKAWTVSSSACSADNYLKMLAAINPSFDGNRRA
ADILAEKIDTLLDDAHLPTNIKSCHIREKDYLQRIEDLALRSFEQLSAICADAGSGYPLV
SEIVRILKDIY
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgactgattttttatatcctgatattttgaatgaacaactgacctatgccagacaggca
cgtgccgcatggctttggaccaatgttgccgaacgaagccggatttttctgcaagttctg
gatacccttcagcccatctgcgcatcccttgcccgtgacagcgtccaagagacgggctac
ggtatttttgaggacaggatgctcatgatcacacgcctgcttcgtgacctccgttcctgc
tgccttcaaacagaatctcccttttcagaacgtctttcctgcacggacacacacacccaa
agccagccctccggcactttgcttggtataccatcatccatacatccggtcactgaaacc
ctctttgccgctgctattgccattcaaacaggaaatccgctcatttttttcttttctgac
agtgcatttcagatatcagcccgaacagcctccctgatccgtgatgctgcaattgctgcc
ggtgcacctgacaactgcattcaatggctggaaattgctgatgacaacctgcttgaaaaa
tgcaatcactgtcccgacatcagcggccttattctttccggactttccgccaatatccgc
aaagtattttctgctttttcagcggaatgtatcctttcctttccacagcctgctttctgc
tatatccactacagtgctgatccgacacttgctgcaaggcagattgttttatccaaaacc
tttgacaacggaatgtgcttgaacggtgagcagataatctgtgccgatgctgtgatcctg
ccgccgctgaaagatgccctgcgccgcaccggcggttattttgcatccccggaagaaatt
gtccgcctcactgcgattcttgccaacctttcggacaatacagttaatccttctgttatc
ggacaatctgcgcaggcactggctgatctggccggtattgtcattcctgaatccacccgc
ctcattattcttgaaatcgaaccggataatgcttcccacccacttcttctgccctttttg
tgcccggttcttgtactgatatcggtgaatgattatgaacaggcagccgacaaaattcgt
cttttatccacaaaaagtgcatctttttccactgacttccctttttccgacacccgcccc
ctgccgacacatcattatcttgcgctttatgccgccgacaatgcaccgatttcattttta
tcctatgcacttccggatttttccataattgaaaatgctccggctgcttctgtatccatg
atccagcaatatatggatatctatggccatcttcttccttcttcagccattcctcagctt
ttttccatccgccgctgccattcgacaatgatcgaaaccgcccgctgcttttcttttcct
gcagaaatttattatgggcaaaatccccttgaacaactgaaactttatgaacatgaagac
catcttctctttctgcagtgtcccgcattttcagaatctgccgttcagactgtcataaaa
aggatacagcaaaaatacccctttattcagtatgaatgcctaaagcttgcgcccgatgat
tcacagatcaccgactttctctgccagcactcgctttttcctgaactgcctgctgcaccg
gattgtctcattgtcatcggtgacagcaccgctgtccatattgccaaaatgctcatgacc
cgttatcagcaatccgcaagttcttccctcccacgcctgatcatcatgacttcggatgcc
ggatgccatgcggcgcttctgcctttttatccacactatgacagctgcagcaaccgattg
acagatatgtcctgccggctttcctattttacattgattgctgacagccatttttccttt
tttcgaagccacaaacatctgatcagtgccagcatggctgctatggccgatgcttttgat
tctctcttattcgtcggcggagatgatatttccgatgctatggctttccgttccattcag
ctgtttcttgtctggcttccgctttttttgtccgccccctccgaaagagggcatcaaaaa
aacaggcctgacgcctgtttggaacatttgcaaaatgcatgtattttatccggactggcc
tgttctcataccggcctcggcctttctcatatcctctcacaacaattatgctgtgaattt
cggatatcgatgtctgccttgcaggcactcctgataccccgtctgctcctgtattatggc
agtgattccacacatctctccggaaaagcctggacggtttcttcctccgcctgctctgct
gataactatttaaaaatgctggctgccatcaatccatccttcgacggaaaccgacgggca
gccgatatactggccgaaaaaattgacacacttcttgatgatgcccatctcccgaccaat
attaagagctgccatatccgagaaaaagactatcttcagcgcatagaggacctggctctg
cgcagttttgaacagttgtccgccatctgtgccgatgccggatccggatatccgctggtc
agtgaaattgtccggattctaaaggatatctattag

DBGET integrated database retrieval system