KEGG   Cryptobacterium curtum: Ccur_03630Help
Entry
Ccur_03630        CDS       T00962                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ccu  Cryptobacterium curtum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ccur_03630
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ccur_03630
Enzymes [BR:ccu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Ccur_03630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
420689..422134
Genome map
AA seq 481 aa AA seqDB search
MCVALDRVASNPNALPNLLDQLDRFWETHWDEMLADLDRLVAIESVEDLAHAAPGAPFGP
GPAQALETFLTIADRMGFTTKNVDGYAGIADMVGDSPVQVGIIGHVDVVPIGEGWTVDPL
RVTVRDSFLLGRGTSDDKGPLLMSLYAAKFWMDKGRALPYTLRYIVGANEETGMRDVEQY
RKIHGDPAVVFTPDDEFPACYGEKGQIQGAITSPQLAGVIQDIQGGIAPNAVPGSASALV
AVPAVRLKPADGIEIETRDGGTFVTARGVQAHAAMPESGTSAILHLVAYLAASGICSPAE
QQWLSCLETWLGDFSGMGLGIASCDEAFGPLTAVGGMISMQNGRIRQTIDIRFTTASDPD
VLEKTLVSLTQSAGGVWETTRLAPVFLMNPESPFMQALISSYRAVTGDNQPAFTIGGGTY
ARHFPCAAGFGASVCGKAYPSWVGGMHAADEGVAIADLKNAFKVYAVAIDRLMALDLCGE
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
ttgtgtgttgctttagatagagtagcatccaatccaaatgcactccctaatttgctcgat
cagcttgatagattctgggaaacccattgggatgaaatgcttgccgatctcgaccgtctg
gtcgctatcgaaagtgtagaagatcttgcgcacgcggctccgggggctccatttggcccc
ggaccagcacaagccctcgaaacatttcttaccatagctgaccgaatgggctttacaaca
aaaaatgtcgatggctacgctggaatagccgatatggtaggagattcaccagttcaagta
ggtattattggccatgttgatgttgtccccattggcgaagggtggacagttgatcctctg
cgcgtaacggtgagggacagctttttgctcggacggggaacctccgacgataaaggtccg
ctgttgatgtccttgtatgcggcaaagttttggatggataaaggtcgcgcgctgccttac
accctgcgctatatcgtgggcgccaacgaagaaactggcatgcgcgatgtcgagcagtat
cgtaagatacacggcgacccagctgtcgtatttacccctgatgacgaatttccagcctgc
tatggcgaaaaggggcagatccaaggcgcaatcacatccccgcagcttgctggtgtcatt
caagatattcagggtggtattgctccgaatgcggtaccgggaagcgccagtgcccttgtc
gctgttccagcggtccgcttgaagccagcggatggaattgaaattgagacacgcgacggg
ggaacatttgttactgcgcgcggtgtgcaggctcatgcggctatgcccgaatccggcacg
agtgcgatcttacacttagttgcatacttggcggcctcaggtatctgttcaccagctgaa
cagcagtggctttcttgtttggaaacctggctgggcgatttttctggtatgggccttggc
attgcttcgtgtgacgaagcctttggtccgctgactgcggttggtggcatgatcagtatg
cagaatggccgtatccggcagacgatcgacatccgatttaccaccgcaagtgatcctgat
gtccttgaaaagacactcgtttctctgactcaatcagctggcggcgtgtgggaaacaacg
cgtttggcgccagtctttctgatgaacccagagagtccctttatgcaagcgctcatttca
agctatcgcgctgttaccggcgacaaccagccggccttcaccattggtggcggtacctat
gcacggcatttcccctgtgccgcgggatttggcgcgagtgtgtgcggcaaagcgtatccc
tcctgggtaggaggcatgcacgcggccgatgaaggagtcgcaatagccgacttaaagaat
gcgttcaaggtatatgccgtagcgattgaccgtttgatggcgcttgatctttgtggagaa
ctgtag

DBGET integrated database retrieval system