KEGG   Cryptobacterium curtum: Ccur_05040Help
Entry
Ccur_05040        CDS       T00962                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ccu  Cryptobacterium curtum
Pathway
ccu00040  Pentose and glucuronate interconversions
ccu00052  Galactose metabolism
ccu00500  Starch and sucrose metabolism
ccu00520  Amino sugar and nucleotide sugar metabolism
ccu01100  Metabolic pathways
ccu01130  Biosynthesis of antibiotics
Module
ccu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ccur_05040
   00052 Galactose metabolism
    Ccur_05040
   00500 Starch and sucrose metabolism
    Ccur_05040
   00520 Amino sugar and nucleotide sugar metabolism
    Ccur_05040
Enzymes [BR:ccu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Ccur_05040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Glycos_transf_2 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACU94225
UniProt: C7MMT5
Position
595751..596578
Genome map
AA seq 275 aa AA seqDB search
MKAVIPAAGMGTRFLPATKAVPKEMLPVVDRPVIQYIVEEALDSGADEVIIVNNRTKQAI
EHHFAPDAELEATLTARGKTALAEKVQHAGSLPVTFVYQDEALGLGHAVHCAAAVTGGEP
FFVLLGDVIAEDGSMLARMREISEAHEGANVIAVLPVAREEVSRFGVISGSEVSAGVWKV
NSLVEKPAVDEAPSNLTVFGRYLLSPRVMELLAGVAPGAGGEIQLTDALDAVLAEEEMYA
LVIDDDDGFDTGTPETWLDANVRLAARSRKAHDIR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggttattcctgcggcggggatgggaactcgctttctaccagcaaccaaggca
gtgccaaaggaaatgctgcccgtggtcgaccgcccggttattcagtacattgtggaagaa
gcgctcgattcgggcgcggatgaagtgattatcgtaaacaatcgcaccaaacaggcgatt
gagcatcactttgcgcccgatgcagaactcgaagcaaccttaacagcacgcggtaaaact
gcgctggctgaaaaggttcagcatgcgggcagtttgccagtgacgtttgtgtatcaagat
gaagcactgggccttgggcatgcggtgcattgtgcggctgctgtcacgggtggggagcca
ttctttgtcctgttgggcgatgtcattgctgaagatggcagtatgcttgcgcgcatgcgt
gagatttccgaagcacacgagggcgccaacgttattgcagtgcttcccgttgcacgcgaa
gaagttagtcgtttcggtgttatcagcggaagcgaagtgtctgcgggggtatggaaggta
aacagcctggttgaaaagcccgccgttgacgaagcgccatctaaccttacggtatttggt
cggtatctgctgagtccgcgcgtcatggagcttttggccggtgtggcaccaggtgctggt
ggggaaatacagttgaccgatgcgctcgatgcggttttagcagaagaagagatgtacgcg
ctggtgattgatgatgatgacggatttgacaccggtacaccagagacctggcttgatgcc
aatgtgcgtcttgctgcgcgatctcgaaaagctcatgatatacgttaa

DBGET integrated database retrieval system