KEGG   Cryptobacterium curtum: Ccur_05530Help
Entry
Ccur_05530        CDS       T00962                                 

Definition
(GenBank) peptidase family protein
Organism
ccu  Cryptobacterium curtum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
654438..655673
Genome map
AA seq 411 aa AA seqDB search
MNEEQLSFLETMVATPSVTGCEHLVASLVRERLADVADEIDTDVMGSVHARVRGTGVPND
AALSAQTDGGASGEEAAGVTNEAETAGVTNETAAATASDEVTAATASDEAAPRVPSVLIA
AHMDEIGLMVNYISDEGFLSVKPVGGVDAGLLPGLRVDVHTDEGALRGVVGRQPIHLVPA
DERKQVAPFEKLVIDLGMPADMVKQRVQIGDTVTYGVGFERFGDGMAVSRAFDDKAGVFI
GIGVACELARGPRAAADFILAATVQEEIGLRGGLTSAYSVDADVCLAFDVTHATDYPGID
KAKHGNIVCGGGPVIARGPNINPVVFNRLVAAAQAEGIDYQIEAEPGVTGTDAGEMQIQR
GGKACGLVSLPLRYMHTPTEVINLSDVDGCIKLLARFIRDLDADVSFVPGM
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagagcagctttcattcctcgaaactatggtagcaacaccttcggtaacggga
tgcgagcacctggttgcaagtcttgttcgagagcgcttagccgatgtcgctgatgaaatc
gataccgatgtcatgggctcggtgcatgcacgcgtgcgggggacaggtgttcccaacgac
gcagcattatctgcacagacagatggcggagcttctggtgaagaagcggcaggcgtgacg
aatgaggccgagacagcaggcgtgacgaatgagaccgctgcggcaacagcatcagatgaa
gtcaccgcggcaacagcatcagatgaagcagcaccccgtgttccttcggttttaattgct
gctcacatggatgagattggccttatggtcaattacatttctgacgagggttttctcagt
gtaaaaccggttggtggtgttgacgctggtctgcttcctggattgcgggtggatgtgcac
actgacgaaggagccctgcgcggagttgttggccgccaaccaattcatttggtacctgcc
gatgaacgcaagcaggtggctcctttcgaaaagcttgttattgatcttggtatgccggct
gatatggttaaacagcgcgtacagataggcgataccgtaacgtacggagttggctttgag
cgcttcggcgatggtatggccgtgtcgcgtgcctttgacgataaagcaggcgtttttatt
gggattggcgtagcgtgcgaactggcacgcggtccacgtgcagcggctgatttcattctt
gctgctaccgtacaggaagaaatcggtttgcgcggtggactcacgagcgcttacagcgtg
gatgccgatgtgtgcctggctttcgatgtaacgcatgccactgattatcccggtattgat
aaggcaaaacacggcaacattgtctgtggcggtggaccggttattgcgcggggtccgaat
atcaatcctgttgtctttaatcgtcttgtcgcagcagcgcaggctgaaggaattgattat
cagatagaagctgaaccgggtgtaaccggcaccgatgcaggggaaatgcagattcaacgt
ggaggtaaagcatgcggattggtgtcgttgccactgcgctatatgcataccccgacggaa
gtcatcaatctgtccgatgtggatggctgtattaagcttcttgcgcggttcattcgcgat
ttagatgctgacgtttcgtttgtgccggggatgtaa

DBGET integrated database retrieval system