KEGG   Cryptobacterium curtum: Ccur_05530Help
Entry
Ccur_05530        CDS       T00962                                 

Definition
peptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ccu  Cryptobacterium curtum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ccur_05530
Enzymes [BR:ccu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Ccur_05530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
654438..655673
Genome map
AA seq 411 aa AA seqDB search
MNEEQLSFLETMVATPSVTGCEHLVASLVRERLADVADEIDTDVMGSVHARVRGTGVPND
AALSAQTDGGASGEEAAGVTNEAETAGVTNETAAATASDEVTAATASDEAAPRVPSVLIA
AHMDEIGLMVNYISDEGFLSVKPVGGVDAGLLPGLRVDVHTDEGALRGVVGRQPIHLVPA
DERKQVAPFEKLVIDLGMPADMVKQRVQIGDTVTYGVGFERFGDGMAVSRAFDDKAGVFI
GIGVACELARGPRAAADFILAATVQEEIGLRGGLTSAYSVDADVCLAFDVTHATDYPGID
KAKHGNIVCGGGPVIARGPNINPVVFNRLVAAAQAEGIDYQIEAEPGVTGTDAGEMQIQR
GGKACGLVSLPLRYMHTPTEVINLSDVDGCIKLLARFIRDLDADVSFVPGM
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagagcagctttcattcctcgaaactatggtagcaacaccttcggtaacggga
tgcgagcacctggttgcaagtcttgttcgagagcgcttagccgatgtcgctgatgaaatc
gataccgatgtcatgggctcggtgcatgcacgcgtgcgggggacaggtgttcccaacgac
gcagcattatctgcacagacagatggcggagcttctggtgaagaagcggcaggcgtgacg
aatgaggccgagacagcaggcgtgacgaatgagaccgctgcggcaacagcatcagatgaa
gtcaccgcggcaacagcatcagatgaagcagcaccccgtgttccttcggttttaattgct
gctcacatggatgagattggccttatggtcaattacatttctgacgagggttttctcagt
gtaaaaccggttggtggtgttgacgctggtctgcttcctggattgcgggtggatgtgcac
actgacgaaggagccctgcgcggagttgttggccgccaaccaattcatttggtacctgcc
gatgaacgcaagcaggtggctcctttcgaaaagcttgttattgatcttggtatgccggct
gatatggttaaacagcgcgtacagataggcgataccgtaacgtacggagttggctttgag
cgcttcggcgatggtatggccgtgtcgcgtgcctttgacgataaagcaggcgtttttatt
gggattggcgtagcgtgcgaactggcacgcggtccacgtgcagcggctgatttcattctt
gctgctaccgtacaggaagaaatcggtttgcgcggtggactcacgagcgcttacagcgtg
gatgccgatgtgtgcctggctttcgatgtaacgcatgccactgattatcccggtattgat
aaggcaaaacacggcaacattgtctgtggcggtggaccggttattgcgcggggtccgaat
atcaatcctgttgtctttaatcgtcttgtcgcagcagcgcaggctgaaggaattgattat
cagatagaagctgaaccgggtgtaaccggcaccgatgcaggggaaatgcagattcaacgt
ggaggtaaagcatgcggattggtgtcgttgccactgcgctatatgcataccccgacggaa
gtcatcaatctgtccgatgtggatggctgtattaagcttcttgcgcggttcattcgcgat
ttagatgctgacgtttcgtttgtgccggggatgtaa

DBGET integrated database retrieval system