KEGG   Cryptobacterium curtum: Ccur_07150Help
Entry
Ccur_07150        CDS       T00962                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ccu  Cryptobacterium curtum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ccur_07150
   01230 Biosynthesis of amino acids
    Ccur_07150
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ccur_07150
   00051 Fructose and mannose metabolism
    Ccur_07150
   00562 Inositol phosphate metabolism
    Ccur_07150
Enzymes [BR:ccu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ccur_07150
Exosome [BR:ccu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ccur_07150
  Exosomal proteins of bladder cancer cells
   Ccur_07150
  Exosomal proteins of melanoma cells
   Ccur_07150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
831284..832054
Genome map
AA seq 256 aa AA seqDB search
MTRKVMLAGNWKMNKNWAEAVVLSQAISNQSRGSWESIDIVLCSPACDLKAVYSVLEFDR
SSIKLGAQNVHWEPSGAFTGEISVGMLSEIGVEYCIVGHSERRTLFAETDEMVNRKVHAV
LNGGLIPIVCVGESLGLRDAGTYLDYIRAQVSAALAGLDAEQVARLAIAYEPIWAIGTGR
TATPEAAQEVCAAIRAQVALDFTAETADAMRVLYGGSMKPENARGLLAEADIDGGLVGGA
SLKAESFVQLIEECLS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtaaggttatgctggcaggcaattggaaaatgaataaaaactgggcggaagcc
gttgttctttctcaagccatcagcaatcaaagccgtggatcgtgggagtcaatcgatatt
gtactctgttcgcccgcctgtgatcttaaagcggtttactccgtgcttgaattcgatcga
tcttccatcaagttaggtgcccaaaatgttcattgggagccatccggggctttcacgggt
gaaataagcgttggcatgctttcggagattggcgtggagtactgcatcgttggtcattcc
gagcggcgcacgctctttgctgaaactgacgaaatggttaatcgaaaagtacatgccgta
cttaatggcggtcttattcccattgtttgtgttggtgaatcgcttggtctgcgcgatgct
ggtacctatttggactacattcgcgctcaggtgtccgctgcattggcgggtctcgatgcc
gagcaggttgcacgcttggctattgcctatgaacccatttgggctattggaaccggacgt
accgctacacctgaagcagctcaagaagtttgtgctgccatacgagcgcaagttgcactt
gatttcacggccgaaacagccgatgccatgcgtgtactgtatggcggttcaatgaaacct
gaaaatgcgcgcggactccttgctgaagcagatattgatgggggactcgtaggtggtgca
agcttgaaggcggaatcgtttgtgcaactcatcgaagaatgcctaagctaa

DBGET integrated database retrieval system