KEGG   Cryptobacterium curtum: Ccur_07150Help
Entry
Ccur_07150        CDS       T00962                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ccu  Cryptobacterium curtum
Pathway
ccu00010  Glycolysis / Gluconeogenesis
ccu00051  Fructose and mannose metabolism
ccu01100  Metabolic pathways
ccu01110  Biosynthesis of secondary metabolites
ccu01120  Microbial metabolism in diverse environments
ccu01130  Biosynthesis of antibiotics
ccu01200  Carbon metabolism
ccu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ccur_07150
   00051 Fructose and mannose metabolism
    Ccur_07150
   00562 Inositol phosphate metabolism
    Ccur_07150
Enzymes [BR:ccu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ccur_07150
Exosome [BR:ccu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ccur_07150
  Exosomal proteins of bladder cancer cells
   Ccur_07150
  Exosomal proteins of melanoma cells
   Ccur_07150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACU94425
UniProt: C7MND5
Position
831284..832054
Genome map
AA seq 256 aa AA seqDB search
MTRKVMLAGNWKMNKNWAEAVVLSQAISNQSRGSWESIDIVLCSPACDLKAVYSVLEFDR
SSIKLGAQNVHWEPSGAFTGEISVGMLSEIGVEYCIVGHSERRTLFAETDEMVNRKVHAV
LNGGLIPIVCVGESLGLRDAGTYLDYIRAQVSAALAGLDAEQVARLAIAYEPIWAIGTGR
TATPEAAQEVCAAIRAQVALDFTAETADAMRVLYGGSMKPENARGLLAEADIDGGLVGGA
SLKAESFVQLIEECLS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtaaggttatgctggcaggcaattggaaaatgaataaaaactgggcggaagcc
gttgttctttctcaagccatcagcaatcaaagccgtggatcgtgggagtcaatcgatatt
gtactctgttcgcccgcctgtgatcttaaagcggtttactccgtgcttgaattcgatcga
tcttccatcaagttaggtgcccaaaatgttcattgggagccatccggggctttcacgggt
gaaataagcgttggcatgctttcggagattggcgtggagtactgcatcgttggtcattcc
gagcggcgcacgctctttgctgaaactgacgaaatggttaatcgaaaagtacatgccgta
cttaatggcggtcttattcccattgtttgtgttggtgaatcgcttggtctgcgcgatgct
ggtacctatttggactacattcgcgctcaggtgtccgctgcattggcgggtctcgatgcc
gagcaggttgcacgcttggctattgcctatgaacccatttgggctattggaaccggacgt
accgctacacctgaagcagctcaagaagtttgtgctgccatacgagcgcaagttgcactt
gatttcacggccgaaacagccgatgccatgcgtgtactgtatggcggttcaatgaaacct
gaaaatgcgcgcggactccttgctgaagcagatattgatgggggactcgtaggtggtgca
agcttgaaggcggaatcgtttgtgcaactcatcgaagaatgcctaagctaa

DBGET integrated database retrieval system