KEGG   Cryptobacterium curtum: Ccur_07800Help
Entry
Ccur_07800        CDS       T00962                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ccu  Cryptobacterium curtum
Pathway
ccu00230  Purine metabolism
ccu01100  Metabolic pathways
Module
ccu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ccu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Ccur_07800
Enzymes [BR:ccu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Ccur_07800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 AAA_18 RsgA_GTPase AAA_22 ABC_tran NTPase_1 AAA_29 MMR_HSR1 cobW CPT AAA_23
Motif
Other DBs
NCBI-ProteinID: ACU94484
UniProt: C7MNJ4
Position
complement(895607..896176)
Genome map
AA seq 189 aa AA seqDB search
MSRTGNLFVISGPSGAGKGTLVKRVLDRVPDAWVSISATTRAPRAGEVDGVSYFFLSDDQ
FDDLIAQDGFLEWASVHTARYGTPRASVEERLAAGVQVILEIDVQGAFQVKRYMPECHLV
FIAPPSMEELRARLEGRGSETPEAIAERMATAEVELAQKKKYDYTVVNDNLDEATDQLVA
YIESLAERE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcgaactggcaacctgttcgttatctcaggtccatcgggcgcgggtaagggcaca
ctcgtaaagcgtgtccttgaccgcgtccccgatgcatgggtttccatttcagctacaacc
cgtgcccctcgtgccggggaagttgatggtgtctcatatttctttctttctgacgatcaa
ttcgacgatcttattgcgcaagatggcttccttgaatgggcttcggtgcacaccgcgcga
tatggtacgcctcgcgcaagcgtagaagagcgcttagctgcgggtgttcaagttattctt
gaaatagatgtacaaggtgcttttcaggttaaacgctatatgccagagtgccatctggtt
tttatagctcctccaagtatggaagagctgcgtgcgcgcctcgaaggtcggggaagtgaa
actcctgaagcgatcgctgaacgcatggcgacagcggaagtggaacttgcgcagaaaaag
aagtatgattacacggttgttaatgacaaccttgatgaagcgaccgaccagctggtcgct
tatatcgaatcgctggcggaacgagaataa

DBGET integrated database retrieval system