KEGG   Cryptobacterium curtum: Ccur_07860Help
Entry
Ccur_07860        CDS       T00962                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ccu  Cryptobacterium curtum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ccur_07860
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ccur_07860
Enzymes [BR:ccu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Ccur_07860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(900560..901504)
Genome map
AA seq 314 aa AA seqDB search
MAFNHKNLIDIREYSADDIMQLLETAVSFMEVNERKIKKVPLLKGMTVVNMFNEPSTRTR
SSFELAEKRLSCDSLNFGGKSTSLVKGESLVDTLETLDAYKIDMVIVRDKHAGVPHLISQ
HTDAAVIDAGDGKHNHPTQALLDLFSIWRAKGTLEGLSVGIVGDIGHSRVAGSLVPALKI
MGCTVTLIAPNTLLPAMPELLGADAVTADLDAVLPELDVVYMLRIQRERLEGAPFPSLRE
YNMLFGLTRQREQLMRPDAIICHPGPINRGVELDSYMADHPSRSMILDQVYAGICTRMAA
LYLLLGGSENGFTA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggctttcaatcataagaatctcattgatattcgcgaatattcggcagatgacattatg
caactgcttgaaactgcggtttccttcatggaagtcaatgaacgcaagattaagaaggtg
ccgctgctcaagggcatgacggttgtcaatatgtttaatgaaccgtcgacccgtacgcgt
tcaagctttgaactggctgaaaagcgtttatcgtgcgatagcttgaactttgggggcaag
agtacgtcgttagtgaagggcgaaagtcttgttgatacccttgaaacgcttgatgcctac
aaaatcgatatggtcattgtgcgtgacaaacatgctggtgttccccatttaatttcgcag
cataccgatgcggctgtgattgatgcaggcgacggcaagcacaatcaccccactcaggcg
cttttggatttgttttccatttggcgggcgaaaggaacgcttgagggtctttcggttggt
attgtgggtgacatcggtcattcacgagttgcgggctcgcttgtaccggcgttaaaaatt
atgggttgtaccgtcaccttgattgcaccgaataccttgttgccggctatgccagaattg
ctcggtgccgatgcggttaccgccgatcttgatgcggttttgcctgaactggatgtcgta
tatatgctgcgtattcagcgtgaacggttagagggagcaccattcccgagtctgcgtgag
tacaacatgcttttcggacttacgcgtcaacgcgaacaactaatgcgtcctgatgccatt
atttgtcatccggggcccatcaaccgcggtgttgaacttgatagttacatggcagatcac
ccgagtcgttcgatgattctcgatcaggtgtatgccggtatctgcacacgtatggcagcg
ctgtatctgctgctgggagggagcgaaaatggctttactgcttaa

DBGET integrated database retrieval system