KEGG   Cryptobacterium curtum: Ccur_08090Help
Entry
Ccur_08090        CDS       T00962                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ccu  Cryptobacterium curtum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ccu00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(925423..926001)
Genome map
AA seq 192 aa AA seqDB search
MPNALVLVDVQNDFCTGTLAVEDGPEVACAIASYVREQAADYDYIVTTQDWHIDPGSHFS
DQPDFRDSWPIHCVADTWGSELFTDVRDALNTAPSEKVVSIIKGMQCASYSGFEGVLRGD
SSQSMDAFLTAQGITNLVIVGIATDYCVDATIRDAVQQGYHVETIASLCAGINADRVGEI
YTEYPHLGVTVR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtgccaaatgcattggtacttgttgatgtgcaaaacgatttttgcactggtacgcttgcg
gtagaggatggaccagaggttgcctgtgccattgcgtcatatgtacgcgagcaggcggct
gattacgactacatcgtgacgacgcaagattggcatattgatcccggttctcatttcagt
gatcaacccgattttcgtgacagctggcccattcattgtgtggctgatacctggggaagc
gagctttttaccgacgtgcgtgatgcattgaatacagctccgtctgaaaaagttgtatcc
attataaaaggaatgcaatgcgcaagttatagcggctttgagggtgtgttgcgcggcgat
tctagccagtcgatggatgcctttcttaccgcacaaggtataactaatctggtgattgtt
ggcattgcgactgattactgtgtggacgcaacgatacgcgatgccgtgcaacagggctat
cacgttgagacaattgcttctctgtgcgctggtatcaatgcagatcgcgtaggggaaatc
tatactgagtatccacacttaggggttacggttcgctag

DBGET integrated database retrieval system