KEGG   Cryptobacterium curtum: Ccur_08360Help
Entry
Ccur_08360        CDS       T00962                                 

Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, beta subunit
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
ccu  Cryptobacterium curtum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ccu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ccur_08360
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ccur_08360
   00020 Citrate cycle (TCA cycle)
    Ccur_08360
   00620 Pyruvate metabolism
    Ccur_08360
   00640 Propanoate metabolism
    Ccur_08360
   00650 Butanoate metabolism
    Ccur_08360
  Energy metabolism
   00680 Methane metabolism
    Ccur_08360
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ccur_08360
Enzymes [BR:ccu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ccur_08360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(955793..956740)
Genome map
AA seq 315 aa AA seqDB search
MSLNARTLPTEEPFFGHKACAGCGGSLVLRQALKVLGPHAIAALPAGCMSAVGFNFPQLC
FANNAMITPFAATAAVLSGIDAGLRAQGCKPDDCTVVGFAGDGGTADIGIQALSGAIDRN
EDILYICYDNEAYMNTGIQKSSLTPFGARTTTTPVGANLHGCTTDKKNMFEIVVAHGIPY
AATASIGYAPDFLRKVAKARDMKGTRYLHVIAPCPTGWGCPDRDMVDIAREVVDAGLWYL
AEYEGPQTSQTPAGRLKLNRRPAQFASGADEWGSVEHYLRRQARFAALDGEDIARIEAGR
DEMWERLERLTTAFS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaaatgctcggacccttccaaccgaagaaccctttttcggtcataaggcgtgt
gctggctgtggcgggtcacttgtgctgcgacaggcactcaaggtattaggtcctcatgcc
atagccgccctgccagctggttgtatgagtgctgtggggttcaacttccctcaactgtgc
tttgcgaacaacgctatgatcacacccttcgcggcaaccgctgcagtgctgtcaggtatt
gatgcggggctgcgcgctcaaggatgtaagcctgacgattgtactgtcgtcggttttgct
ggcgatggtggtaccgctgatattggtatacaggcactatctggcgctattgatcgcaac
gaagatattctctatatctgctatgacaatgaagcttacatgaataccggtatacagaag
agttctctgacgccgtttggcgcacgtacaacgacaacgccagttggcgccaatctgcat
ggctgcacaacggataagaagaacatgtttgaaattgttgtcgctcatgggattccttat
gcggcgacggcgagcattggatatgctcccgatttcttacgcaaggtggctaaggcacgc
gatatgaaaggtactcggtatcttcatgtgattgcgccgtgtcccacgggatggggctgt
cccgatcgtgacatggtcgatattgcccgtgaggtggttgacgcggggctgtggtatctc
gctgaatatgaaggaccgcagacttcccagacaccagccggtcgtttgaaactaaaccgt
cgacccgctcagtttgcgtcaggtgccgatgaatggggatcagttgagcattatcttcgc
cgacaagctcgttttgcagcgcttgatggtgaagatatcgcccgtatcgaagcggggcgc
gacgaaatgtgggagcggcttgaacggctgacgactgccttttcgtaa

DBGET integrated database retrieval system