KEGG   Cryptobacterium curtum: Ccur_08370Help
Entry
Ccur_08370        CDS       T00962                                 

Definition
2-oxoacid:ferredoxin oxidoreductase, alpha subunit
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
ccu  Cryptobacterium curtum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ccu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ccu00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ccu00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ccu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ccu00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ccu00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:ccu00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:ccu00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(956731..957957)
Genome map
AA seq 408 aa AA seqDB search
MGERRFLSGDEAFAEGVRLARPQVISAYPITPQTVVVERLSEMVESGSLTAEYIHVESEH
SALAAAIGAAATGARTFTATSSQGLLYMAECLTYASGGRFPIVMMNANRATCLPWNIYGD
QRDSLSLLDHGWIQAYAKDAQEALDMALIAYAVAEDARIMTPVMVNLDGFALTHTYETVD
IPTSEEADAFLPPYQTSNRFDFENPTNMAFSAGPAYNRYFKQSEHIDMLRTSEVLADVEK
RFADIVGRQWPGMIETWGCDDAEVILVVLGSVAGLACEVAEHLRQQGRAVGVVRIRYLRP
MPAAEIVAALSGAQAIGVLEKDISFGAEGTVFTNVSSALFNAGLCLPAVNFIGGLGGDDI
TEDQMRHVFDQLFSCAQGNKHDSVEFFNIETPSRSEVNEALKGVPSCH
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagagacgatttctctcaggtgatgaggcatttgccgaaggagtgcgccttgcc
aggccgcaggttatatcggcgtatcccattaccccacagactgttgttgtcgaacgttta
agcgaaatggtggaaagcggaagcttgaccgccgaatacattcatgttgaaagcgagcat
tcagcacttgcggcggctattggcgctgcggcaacgggcgctcgtacgtttactgcaacg
tcgagccagggactgctctatatggctgagtgcctcacgtacgcatcgggtggacggttt
cccattgtaatgatgaatgccaatcgcgcgacatgtctgccgtggaacatctatggcgac
cagcgcgattcgctttccctgcttgatcacggttggatacaagcatatgccaaagatgcc
caagaggcgcttgacatggcacttatcgcctatgccgttgcggaggatgcgcgcattatg
acgccggttatggttaacctcgatggatttgccctcacacacacctacgaaacagtggat
attcccacatcagaagaggctgatgcatttttgccgccctatcagacgagcaatcgattt
gattttgagaacccgaccaatatggcgtttagtgcaggtccggcgtataaccgttacttt
aaacagagcgaacatatcgacatgctgcgtaccagtgaagttttagccgatgttgaaaag
cgctttgctgacattgttggtcgtcagtggccagggatgatagagacttggggctgcgac
gatgccgaagttattcttgtggtgcttggttcggtcgctgggcttgcatgcgaagtagct
gaacatttacgccaacaggggagagcagttggggttgttcgcattcgctatctccgtccg
atgcccgctgccgagattgtcgcagcgctttcgggggcacaagcaatcggcgtgcttgaa
aaagacatttcctttggcgctgagggaacggtattcaccaatgtatcgagcgcattgttt
aacgctggcctgtgtctgccagctgttaactttattggcggtcttggcggtgatgatatt
accgaagatcagatgcgacatgttttcgatcagctgttttcctgcgcacagggaaataag
cacgattcagtagagttttttaacatcgaaacgccatcgaggtctgaagtaaatgaagcg
ttgaagggggtgccgtcatgtcattaa

DBGET integrated database retrieval system