KEGG   Cryptobacterium curtum: Ccur_08380Help
Entry
Ccur_08380        CDS       T00962                                 

Definition
(GenBank) 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family/2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
ccu  Cryptobacterium curtum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ccu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ccur_08380
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ccur_08380
   00020 Citrate cycle (TCA cycle)
    Ccur_08380
   00620 Pyruvate metabolism
    Ccur_08380
   00640 Propanoate metabolism
    Ccur_08380
   00650 Butanoate metabolism
    Ccur_08380
  Energy metabolism
   00680 Methane metabolism
    Ccur_08380
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ccur_08380
Enzymes [BR:ccu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ccur_08380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(957957..959024)
Genome map
AA seq 355 aa AA seqDB search
MVDVIWHGRGGQGAFTAARLLGAAWCYEQGHQALAFPTFGPERRGAPMCAFTRLDTGPIG
VRGAPTQADVVVYLDDTLLSSGWEQELTAGGVVLVNTARTIDDSRVVCLDASAISTELLG
RAIPNTALLAALTNLIEGFTAKTLNRAISEQLPARLHAGNHAVVERVCAMEVGVPSVAPA
VSESNALADNQDIPASHLDVPAGHSNASTDSSDIPVGPPSGTPFIRARKPQPADYARATC
FTAGYLVENNAGWRERRPVVDAQRCTGCLQCYLYCPDGAIKRTPSAAVVVSVDTEFCKGC
AVCEQVCPFDAISMVSEATIKQNAAIQYSSAKSGADTAGTLDNRRTATGAMNKEK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgatgtgatttggcatggcaggggcggacaaggagcgtttaccgctgcacgtctg
ctcggtgcggcttggtgttatgaacagggccatcaggccctcgcatttccaacgttcggt
cctgagcgccggggtgctcccatgtgtgcgttcacgcgtttggacacgggtcctattggc
gtgcgtggagcgcccacacaggcggatgtagtggtctatcttgacgatacgctgctatcg
tctggatgggaacaggaactgactgctgggggagtggttcttgttaatacggctcgcact
atcgatgacagtcgggttgtttgccttgatgcaagcgctatttctaccgaactgcttggg
cgcgctattccgaataccgcactgcttgccgcactaacaaatcttattgaggggtttact
gcaaaaacacttaatcgtgccatcagtgaacagctacctgcgcgcctgcatgctggcaat
catgccgtggtcgagcgcgtgtgtgccatggaggttggtgtgccttcggttgcgcctgcg
gtttctgaatcgaatgcgctagcggacaatcaagatataccagccagtcatttagatgta
ccagcaggtcattcaaatgcatcaacagacagctcagatataccagtaggtcctccgtct
ggcactccctttatacgtgcgagaaagccacagcctgccgattacgctcgggcaacgtgc
tttactgcgggatacttagttgagaacaatgccgggtggcgcgagaggcgaccggtggtg
gacgcacagcgttgtacgggctgcttgcaatgttatttgtactgccctgatggcgctatc
aagcggacaccgtctgctgccgtagttgtatcagtggataccgaattttgcaaaggatgc
gctgtctgcgaacaggtatgcccctttgacgccatttcaatggtgtcagaagcaactatc
aagcagaatgccgccatccagtattcctcagccaaatcaggggcggatacagctggtaca
ttagataacagacgtaccgcaacaggcgcaatgaacaaggagaagtaa

DBGET integrated database retrieval system