KEGG   Cryptobacterium curtum: Ccur_08510Help
Entry
Ccur_08510        CDS       T00962                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ccu  Cryptobacterium curtum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ccu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Ccur_08510
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Ccur_08510
Enzymes [BR:ccu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Ccur_08510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
975780..976322
Genome map
AA seq 180 aa AA seqDB search
MRVYDYTATNLDGSEAPLSAYKGDVLLVVNTATGCGFTPQYEDLEKIYANHRTKGFEILD
FPCNQFREQAPGSDEEIHQFCTMKFGTEFPQFKKIDVNGENAFPLFKEMATEKPFVGFGR
GPKALMMNQVAKSVDKEFGDAAYIKWNFTKFLFDREGNLIERFEPTAKMEDVEAAIEKLL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtctatgattacaccgcaaccaaccttgatggcagcgaagcacccctgagtgcg
tataagggggatgttcttctagtggttaacactgcgaccgggtgtggatttaccccgcaa
tacgaagacctcgagaaaatatatgcaaaccatcgcacaaaagggtttgaaatcctcgac
tttccatgcaaccagttccgcgagcaagcacctggcagcgatgaagagatccatcaattc
tgtacgatgaaatttggaacggaatttccccagttcaaaaagatcgatgtcaatggcgag
aacgcctttccgctcttcaaggaaatggcgactgaaaagccctttgttggctttggtcgt
ggcccaaaggcactcatgatgaaccaggtggctaagtcggttgacaaagaatttggtgat
gccgcctacatcaagtggaacttcaccaaattcctgttcgatcgcgaaggtaaccttatc
gagcgcttcgagcccactgccaagatggaagatgttgaagcagccattgaaaagctgctc
taa

DBGET integrated database retrieval system