KEGG   Cryptobacterium curtum: Ccur_10890Help
Entry
Ccur_10890        CDS       T00962                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ccu  Cryptobacterium curtum
Pathway
ccu00900  Terpenoid backbone biosynthesis
ccu01100  Metabolic pathways
ccu01110  Biosynthesis of secondary metabolites
ccu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ccu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ccur_10890
Enzymes [BR:ccu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Ccur_10890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Sacchrp_dh_NADP Semialdhyde_dh NAD_binding_3 DapB_N
Motif
Other DBs
NCBI-ProteinID: ACU94780
UniProt: C7MPE0
Position
complement(1237459..1238661)
Genome map
AA seq 400 aa AA seqDB search
MSSNVLQSSHSGEERLSSKKRVAILGSTGSIGTQTLDVIAQHPDKLEAVALAVGRRTDEA
IAQARAAGVCYVAIGIKDAPAPTVDTTGIEVSFGSDAVVALCRLPEVDVVVNALVGAAGL
QASLETLAAGKVLALANKESLVVGGDLVMPQATHETLLPIDSEHGAIYQCLLGEDPREVR
RLWVTASGGPFRGRTINELQHITPAEALAHPTWHMGPKISIDSSTLMNKGLEVIEAHHLF
AMDYDRINVVVQPQSAIHSMVEFSDGSVKAHLGTTDMRIPIQFALSYPKRWDAPVAPLDF
TQLGSLEFAPADTATFRCLDLARAAGRTGGTLPCAMNAANEVAVAAFLAGKLDYLGIPWV
VETVMDVHEVSSVESFTQLQEIDAWARSHARSACNERTKR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctaacgtgttgcagtcatcgcacagtggggaagagcgcctatcttccaaaaag
cgtgttgccatactgggtagtaccggttctattggcactcagacacttgatgttatcgcg
caacatccggataagcttgaagcggtagctcttgccgtgggtagacgcaccgatgaagct
atcgcgcaggcgcgggcggctggggtttgctatgttgccataggaatcaaagacgcccct
gctccaaccgttgatacaacgggtattgaggtgtcgtttggcagcgatgcggtggtggca
ctctgtcgcctgcccgaggttgatgtggtagtaaatgcgctggttggagcagcgggactg
caagctagtcttgagacgcttgcagctggcaaggtgctggcacttgctaacaaggaatcc
cttgtagtgggcggcgatttggttatgccgcaggcaacgcatgaaacgctgctgcctatc
gattctgaacatggcgctatctatcagtgccttttgggcgaagacccgcgtgaagtgcgt
cggttgtgggtgacggcatcgggtggaccattccgcggccgcactatcaatgaattgcag
catattactcctgccgaagcgcttgcgcatcccacgtggcatatgggtccgaagatatct
attgactcatcgacgctgatgaataagggtcttgaggttatcgaagcacatcacttgttt
gcaatggattacgatcgtatcaatgtggttgtacaaccgcagagtgctattcattcgatg
gttgaattttctgatggaagcgtaaaggcgcatctggggacaaccgatatgcgcattccc
attcagtttgcactcagctatcccaaacggtgggatgccccagtggcgccgctcgatttc
actcagctggggagtcttgaatttgcaccggccgatacagcgacatttcgctgtttagat
ttggctcgtgcggcaggtcgtaccggaggaacactgccgtgcgcaatgaatgccgctaat
gaagtggcagtggctgccttcctggcaggaaaacttgattatttaggtattccttgggtg
gttgagacggttatggatgtccatgaggtctcttcggtcgaaagctttacccagctgcaa
gaaattgatgcttgggcgcgtagtcatgcacgcagcgcatgcaacgagcgcacaaaacgg
taa

DBGET integrated database retrieval system