KEGG   Cryptobacterium curtum: Ccur_11040Help
Entry
Ccur_11040        CDS       T00962                                 

Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ccu  Cryptobacterium curtum
Brite
Enzymes [BR:ccu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Ccur_11040
Transfer RNA biogenesis [BR:ccu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Ccur_11040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1258063..1260063
Genome map
AA seq 666 aa AA seqDB search
MEKPLTSPGTDTSPVTETSPAVDMLSSTDTPCVTDTSPGVDASTVINASPTNEKPTIEGL
ITDIIQALKSSRELDARKLESLIARYNRAWHSPERHFAKRQLLPAYQRMKREHEDLWRTW
HISEQDEAYLIGILQMKPRRSASGVATITVITKPHACASACLYCPNDVRMPKSYLFKEPA
CQRAERNFFDPYLQVASRLEALHEMGHATDKIELIVLGGTWSDYPRSYRTWYARELFRAL
NDSPTERQECCNTRRTAYKKSAIGCEAAELAQQCEPVQALVNAGQITYNEAVGCLFGPQS
SWGTTASWQQTCQEDLFAEHIRNETADHRCVGLVVETRPDAISAESLHALREIGCTKVQI
GVQSTRDEILAANDRGITTATIKQAFRLLRVFGFKIHAHFMVNLLGSTPADDKRDYACFA
DTPAFRPDEVKLYPCALIEGTGLMAHWEKGTWRPYSEDELVDVLTADVLATPAYTRLSRM
IRDISTQDIVAGNKKPNLRQMVEERLRTDGYHEAIREIRFREINRETVDINKLTLKEIVY
QTEVSEEHFLQWVDPTDRIAGFLRLSLPYKSYITAHAGEIPIYAGEAMIREVHVYGVAAH
LHHTDAGVQHLGLGRQLVEQACIIAAKAGFTKLNVISAIGTREYYRRLSFYDNGLYQQRN
LLEPTK
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagccgctcacatcccctggtaccgatacatctcctgtcacagagacatcccct
gctgtagatatgctatccagcacagatacgccatgcgttaccgatacatcacctggtgta
gatgcgtcaactgttatcaatgcatcacccacaaacgaaaaacccactatcgaggggctt
atcacagatattatccaagcactgaaaagctctcgtgaacttgatgcgcgaaaactggaa
tctctgatcgcacgctataatcgcgcatggcatagcccagagcgccactttgcaaaacga
cagttgctaccggcctatcagcgcatgaagcgcgagcacgaagatctctggcgcacctgg
catatcagcgaacaagatgaggcttatcttattggtattttacagatgaaaccccgccgc
agcgcatcaggtgtggccaccatcactgttattactaagccacatgcctgtgcgagcgcg
tgtctctactgtcccaacgatgtacgcatgccaaaaagttacctcttcaaagagcctgcc
tgccaacgtgccgaacgtaacttctttgacccatacctgcaggttgcaagtcgccttgaa
gcgctgcacgagatgggtcatgcaaccgacaagattgagctgattgttttagggggcacc
tggagcgattatccacgcagctatagaacctggtatgctcgtgaactgttccgcgctctc
aacgacagccccaccgagcgtcaagagtgctgcaatacgcgacgcactgcctataagaaa
tctgctatcggttgcgaagctgcggaacttgcacagcagtgcgaacccgtccaagctctt
gttaacgctggacagattacctataacgaagcagtcggttgtctgtttggaccgcaatct
tcttggggcactaccgcaagctggcaacagacttgccaagaagacctcttcgctgaacat
atccgcaacgaaacggcagatcaccgctgtgtcggattagtagtagaaacacgtcccgat
gccatcagcgccgaaagtttacacgctttacgggaaatcggctgcacaaaagtacagatc
ggcgtccaaagtacccgcgacgaaattctcgccgcaaacgatcgcggcattaccacagcc
accatcaagcaggcttttcgccttttgagagtgtttggattcaaaatccatgctcacttt
atggtaaatctcttgggttcaacacccgccgacgacaagcgcgactatgcctgcttcgcc
gatacacccgcttttcgccctgacgaagtaaaactctacccctgcgccctcattgaaggg
actggtcttatggcgcattgggaaaaagggacatggcgcccctattctgaagatgagctt
gtcgacgtactcactgcagatgtgctggctacccctgcttacacgcgcctttcccgtatg
atcagagatatatcaacccaggatattgttgcgggcaataaaaaacccaacttgcgtcaa
atggtagaagaacgcctacgcaccgacggttatcacgaagctatccgcgagatccgtttc
cgcgaaatcaatcgcgaaaccgttgacataaataaacttacgctaaaagaaatcgtctac
caaaccgaggtatccgaagaacatttcttacagtgggttgaccccactgaccgtatcgct
ggctttttacgcctgtcacttccctataaaagctatatcactgcacacgctggtgaaatc
cctatatacgccggtgaagccatgattcgcgaagtgcatgtatatggcgtggcagcgcac
ttacatcacaccgatgcgggcgtgcagcatctgggactcggccgccaactggtcgaacaa
gcatgtattattgccgcaaaagcaggttttactaagttgaatgttatcagtgctattggc
acgcgcgaatactatcgacgccttagtttttatgacaatggcctctatcagcagcgcaat
ttacttgaaccaacaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system