KEGG   Cryptobacterium curtum: Ccur_11980Help
Entry
Ccur_11980        CDS       T00962                                 

Definition
asparagine synthase, glutamine-hydrolyzing
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ccu  Cryptobacterium curtum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ccu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1359274..1361223
Genome map
AA seq 649 aa AA seqDB search
MCGICGFTKTNTDSDQILKNMCNVMAHRGPDGEGRYLDDNIALGHRRLSLIDLEGGSQPM
VRSTGDKTARVTSPARTLDGAFCQDKQSAAARGDYAIVFNGEIYNYQDLRAELEHDGWTF
ATHSDTEVLLVAYLAWGEAALPRLRGMFAFAIWDKKTHELFCARDFFGIKPFYYTEQHGS
FIFASEIKCILEHPAYTRELNEEALEQYLCFQFSALDETFFKGIFKLPQGHCLTVRADGT
CDIKRWWRPSFAPDHAHSEAETVQAIDETMRESVRYHNVADVEVGSFLSSGIDSSYMAAC
LATENPAIHTFTVGFSEYEGERDEISWARELAQELGISNESKHITEQEYWDVLPAVQWHM
DEPSADPSAVALYFVDQLAAKQVKAVLSGEGADEFFGGYRVYETPLENAKLSWCPKPILR
AAAKLLRGLGIRGANYLERASETVEDWYYTNANGVAFSPDQRARLLKKTSATMKTPQQLT
APVYAEASSLDEVTRMQYLDLHFWLVGDILLKTDKMAMAHSLESRVPFLDKEVFNVAASI
PTALKVSDHQTKITLRQAAERAIPTDWAQKQKLGFPVPVANWLKQDKYYGLVKGWFTGEE
AQRFFNTDELVRLLDEHKAGTRDNTRRIWIVYMFLMWYRIYFVDRKKPA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatctgcggattcacaaaaacgaatacggacagcgaccagattctcaaaaac
atgtgcaacgtcatggctcatcgaggacccgatggcgaaggacgctatctcgacgacaat
atcgctttgggacatcgccgcttgtctctgatcgacctcgaaggcggcagtcaaccaatg
gtgcgttcaacaggcgataaaacagctcgggtgacctcccccgctcgcacgcttgatggc
gcattctgccaagacaaacagtcagcggcagcacgcggtgattatgcaatagtattcaat
ggtgaaatatacaactaccaggaccttcgcgccgaactcgaacacgacggttggacgttt
gcgactcattccgacaccgaagtactgctcgttgcctatctggcgtggggagaagcggca
ctcccccgtcttcgtggcatgttcgcctttgccatctgggataaaaagacccacgaattg
ttctgtgcacgtgacttcttcggtattaagccgttctactacacagagcagcacggctcg
tttatcttcgcttccgagattaagtgcattcttgagcaccctgcctatacgcgcgaactc
aatgaagaagcactcgaacagtacttatgtttccagttttcagcgctcgacgaaacgttc
ttcaagggcatttttaaacttcctcagggtcactgtttaaccgtacgtgccgatggcacc
tgcgatatcaaacgctggtggcgcccgtcttttgcgcccgatcatgcacacagtgaagcc
gaaaccgtccaggctatcgatgaaaccatgcgtgaatcggtgcgctatcacaatgtcgcg
gatgttgaagttggatcgtttctttcttctggcatcgattcaagctatatggctgcctgc
ttggctaccgaaaatccggcgattcatacgttcaccgtgggcttttctgaatatgaaggg
gaacgtgacgaaatatcttgggcacgtgaactcgcgcaagaactgggcatatcaaacgaa
agtaagcatataaccgaacaagaatactgggatgtgctaccagctgtgcaatggcatatg
gatgagccatctgctgacccgtcggctgtagcgctttactttgtcgatcagttggccgcc
aaacaggtaaaagccgtactttctggcgagggagccgatgaattttttggcggctatcgc
gtgtacgaaacaccacttgaaaacgctaaactctcgtggtgtccaaaacctattttacga
gcagctgcaaaattgttgcgtggcttaggaattcgcggggcaaattatctggagagggca
agcgaaaccgttgaggactggtactacacaaatgcgaatggtgtggcgttttctccagat
cagcgggcacgcttgctgaaaaagacatcggccactatgaaaactcctcagcagctgacg
gctccggtatatgctgaagcatccagtcttgatgaagttacgcgtatgcaatatctcgac
ctgcacttttggctggtcggcgacatccttctgaagaccgacaaaatggcaatggcacat
tctcttgaatcacgggtgccgtttttggacaaagaagtattcaatgttgctgcttctatt
cccactgcactcaaggtaagcgaccatcaaacgaagattaccctgcgccaagcggctgaa
cgtgccataccaaccgactgggcacaaaagcaaaaacttggctttcccgtgcccgttgct
aactggctgaaacaggacaagtactacgggcttgtcaaaggctggtttactggcgaggaa
gcacagcgctttttcaacaccgacgaactcgtgcgcttactcgacgaacataaagcgggc
acgcgtgataacacgcgccgcatctggattgtctacatgttccttatgtggtaccgcatc
tattttgtcgatcgcaaaaagccagcgtag

DBGET integrated database retrieval system