KEGG   Cryptobacterium curtum: Ccur_12160Help
Entry
Ccur_12160        CDS       T00962                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ccu  Cryptobacterium curtum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ccu00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1381113..1382660)
Genome map
AA seq 515 aa AA seqDB search
MGYVIALDQGTTSSRALLFDRQCGVRGVYQMPFEQHFPQPGWVEHDAFDILRSQISVLDD
LLAAYSLESGDIDSIGITNQRETTILWNRHTGLPIGRAIVWQCRRTAGLIEQVCATPEVR
SHISQVTGLVPDAYFSASKIAWLLDHTPGAREAACAGDLLFGTVDSWLVWNLTGGAVHAT
DVTNASRTMLFDIHRGCWDEELCNLFRIPLSLLPTVRPSSGDFGVTVDDIPAARGHDGLS
FPRIPAGIPITGVAGDQQAALFGQCCTQAGEAKNTYGTGCFLLMHTGSECITSHNSLVST
VAATEPDCTGLAYALEGSVFMAGALIQWLRDALGLIGSEAESEQVARSVEDTAGVYVVPA
FTGLGAPYWDADARGAIFGLTRGATRAHIVRAALESLAYQVSDLMDGMQDDAGMRVRTLS
VDGGASRNDFLMQFQSDILDARLVRPAVAETTAAGAAYLAGLRTGFWRDMDDIRSRRVVE
VTFAPHMASSERLRRLEGWRECVSRTRSERRAVQK
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
ttgggatatgtgatagcgcttgatcagggaacaacctcgtcaagagcgctgcttttcgat
cgccagtgcggcgtgcgtggtgtctatcagatgccgtttgaacagcactttccccaaccg
ggttgggttgaacatgatgcgttcgatattctgcgctcgcagatatcggtactcgacgat
ctgctggctgcctattctcttgagtcgggcgacatcgactctattggcattaccaatcag
cgcgagacaactatcctatggaatcgccatacgggactacctatcgggcgggccattgtg
tggcaatgtcgtcgtaccgctggattaatcgagcaggtgtgtgcaacacctgaagtgcgc
tcacatatttctcaggtaacgggtttagtgcccgatgcctatttttcggctagtaagatt
gcttggttactcgaccatacaccgggggctcgcgaggccgcctgtgctggtgacctgctt
tttggcaccgtcgatagctggctggtgtggaaccttaccggtggcgcagttcatgcgacc
gatgtcacaaacgcgagtcgaacgatgttgtttgatattcatcggggctgttgggatgaa
gaattgtgcaatctctttcgcattcctctgtctttgctgcccacggtgcgcccttcgtct
ggtgattttggtgttaccgttgatgatattccagcggctcgggggcacgacggcttatca
tttccgcgtattccagcgggcattcctattactggcgttgcgggcgatcaacaagctgcg
ctgttcggccagtgttgcacgcaggccggcgaggcaaaaaatacttatggcactggttgc
tttttgctcatgcataccggcagtgaatgcattacatcgcacaacagccttgtttctact
gtcgctgcaaccgagcctgactgtaccggcttggcttatgcgcttgaaggaagcgtgttt
atggcgggcgcgcttattcagtggcttcgtgatgccttaggtcttatcggttcagaagcg
gaaagtgaacaggttgcgcgcagtgtcgaagatacggcgggtgtgtatgtggtgcccgcc
tttactggtttgggtgcgccctattgggacgccgatgcacggggcgctatctttggcctg
acgcgtggtgctacgcgtgctcacattgtgcgtgcggctcttgaatcgcttgcctatcag
gtctccgatctcatggatggcatgcaggatgacgctggcatgcgcgtgcgaacgttgtcg
gttgacggaggggcaagtcgtaacgacttcttgatgcaatttcagtcagacattcttgat
gcgcgtttagtacgcccggccgtagcggaaacaacagcagccggcgcagcttatttagca
ggattgcgcaccggtttctggcgcgatatggatgacattcggtcgcggcgtgtggtcgag
gtcacgtttgcccctcatatggcatcatccgagcgtttacgacgtttggaaggttggcga
gaatgcgtgagtcgtactcgctcggagaggcgagctgtgcaaaaatag

DBGET integrated database retrieval system