KEGG   Cryptobacterium curtum: Ccur_13040Help
Entry
Ccur_13040        CDS       T00962                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ccu  Cryptobacterium curtum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ccur_13040
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ccur_13040
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ccur_13040
Enzymes [BR:ccu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ccur_13040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1470436..1471986
Genome map
AA seq 516 aa AA seqDB search
MTTNRYIDTRNSTVEPIPFTQAVVKGLADGGGLFVPEHIPQLSLEEIVALADIPYAQRAA
RIYRAFDIDLSAEQIESLMQKAYSDNFDTEDICPITSLDEKTHVLELWHGPTSAFKDMAL
QCLPLFFEASAEVLRAEGNIDTEFMILVATSGDTGKAALEGFANRNGVSIGVLYPDGGVS
DIQRKQMITQSGDNVVVWAVRGNFDNCQTSAKRIFNDSDFACKLKTEYGVALSSANSINW
GRLLPQVVYYLSSYAQLVRSSTIEAGQAIDICVPTGNFGNILAAWYAKKIGAPIERLLCA
SNENRVLTDFINTGTYTIVDRPFILTPSPSMDILVSSNLERQLFELTGRDGSAISYWMKD
LAEKGCFRIDPHTFTRLRAEFASDSVSNDECLRTIKETFDAHGYLIDPHTAVACKVAERL
RSDNPVLVASTAHWAKFGGSVYRALHELTVSDSLPREVEQLTDCELNDLISQETGCGPIP
AGLASLDTMKARFTTVIDSDKSAVEEAISLFLSSIQ
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaccactaaccgttatatcgacacgagaaacagcactgttgaaccgatcccctttact
caagcagtcgtcaaaggacttgccgatggaggcggcttgtttgtacccgaacacatcccc
cagctttccttggaagaaattgttgcgctcgctgatattccgtatgcgcagcgtgcggcg
cggatatatcgcgcctttgatatcgatctttctgctgagcaaatcgaatcccttatgcaa
aaagcctatagcgataacttcgatactgaagacatttgtcccattacctcgcttgatgaa
aagacccatgtacttgaattgtggcatgggcccacaagcgcttttaaagatatggcactt
cagtgccttcccctgttttttgaagcaagcgccgaagtgcttcgcgctgaagggaacatt
gacactgaattcatgattctcgtggcgacctcaggtgacaccggaaaggctgcacttgaa
ggatttgctaaccgaaatggcgtctctattggtgtgctctatcctgatggtggcgtaagt
gacatccagcgcaagcaaatgattacgcaatcgggcgacaatgtagtagtttgggcggtg
agaggtaatttcgataattgccaaacgagcgctaagcgtatctttaacgactctgatttc
gcctgtaagctcaaaacggaatatggcgttgctctgtcaagcgctaactccatcaactgg
gggcggctactccctcaagtggtttattacctctcaagctatgcccaactcgtccgcagc
tcaacgattgaggcgggccaagccatcgacatctgcgttccaacaggaaactttggcaat
attctcgcagcatggtatgccaaaaaaattggtgcacctatcgaacgtcttctctgcgcc
agcaacgagaatcgcgtgctgaccgacttcatcaataccggcacctacaccatcgtcgat
cgtccgtttatacttacgccaagtccctctatggatatccttgtgtcatccaatttggaa
cggcagctattcgaactcactgggcgtgatggttctgctatctcatattggatgaaagat
cttgctgaaaagggatgtttccgtattgatccccatacctttacgcggcttcgtgctgag
tttgcaagcgactccgtctccaacgatgagtgcttaagaaccattaaggaaacctttgat
gcacatggataccttatcgatccccatacggcagttgcctgcaaagtcgctgaacgtctt
cgttcggacaatcctgttcttgtcgccagcacagcacactgggccaaatttggcgggagc
gtctaccgagcactccatgagcttacggtgtcagatagtctgccccgtgaagtagaacag
ctaaccgactgcgaacttaacgacctgatttcccaggaaaccggatgtggacccatccct
gcaggattagcctccctggatacgatgaaggcacgtttcaccaccgttattgactctgat
aaatccgctgtcgaagaggctatttcactgtttctttcttcgattcagtaa

DBGET integrated database retrieval system