KEGG   Cryptobacterium curtum: Ccur_13040Help
Entry
Ccur_13040        CDS       T00962                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ccu  Cryptobacterium curtum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ccur_13040
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ccur_13040
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ccur_13040
Enzymes [BR:ccu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ccur_13040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1470436..1471986
Genome map
AA seq 516 aa AA seqDB search
MTTNRYIDTRNSTVEPIPFTQAVVKGLADGGGLFVPEHIPQLSLEEIVALADIPYAQRAA
RIYRAFDIDLSAEQIESLMQKAYSDNFDTEDICPITSLDEKTHVLELWHGPTSAFKDMAL
QCLPLFFEASAEVLRAEGNIDTEFMILVATSGDTGKAALEGFANRNGVSIGVLYPDGGVS
DIQRKQMITQSGDNVVVWAVRGNFDNCQTSAKRIFNDSDFACKLKTEYGVALSSANSINW
GRLLPQVVYYLSSYAQLVRSSTIEAGQAIDICVPTGNFGNILAAWYAKKIGAPIERLLCA
SNENRVLTDFINTGTYTIVDRPFILTPSPSMDILVSSNLERQLFELTGRDGSAISYWMKD
LAEKGCFRIDPHTFTRLRAEFASDSVSNDECLRTIKETFDAHGYLIDPHTAVACKVAERL
RSDNPVLVASTAHWAKFGGSVYRALHELTVSDSLPREVEQLTDCELNDLISQETGCGPIP
AGLASLDTMKARFTTVIDSDKSAVEEAISLFLSSIQ
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaccactaaccgttatatcgacacgagaaacagcactgttgaaccgatcccctttact
caagcagtcgtcaaaggacttgccgatggaggcggcttgtttgtacccgaacacatcccc
cagctttccttggaagaaattgttgcgctcgctgatattccgtatgcgcagcgtgcggcg
cggatatatcgcgcctttgatatcgatctttctgctgagcaaatcgaatcccttatgcaa
aaagcctatagcgataacttcgatactgaagacatttgtcccattacctcgcttgatgaa
aagacccatgtacttgaattgtggcatgggcccacaagcgcttttaaagatatggcactt
cagtgccttcccctgttttttgaagcaagcgccgaagtgcttcgcgctgaagggaacatt
gacactgaattcatgattctcgtggcgacctcaggtgacaccggaaaggctgcacttgaa
ggatttgctaaccgaaatggcgtctctattggtgtgctctatcctgatggtggcgtaagt
gacatccagcgcaagcaaatgattacgcaatcgggcgacaatgtagtagtttgggcggtg
agaggtaatttcgataattgccaaacgagcgctaagcgtatctttaacgactctgatttc
gcctgtaagctcaaaacggaatatggcgttgctctgtcaagcgctaactccatcaactgg
gggcggctactccctcaagtggtttattacctctcaagctatgcccaactcgtccgcagc
tcaacgattgaggcgggccaagccatcgacatctgcgttccaacaggaaactttggcaat
attctcgcagcatggtatgccaaaaaaattggtgcacctatcgaacgtcttctctgcgcc
agcaacgagaatcgcgtgctgaccgacttcatcaataccggcacctacaccatcgtcgat
cgtccgtttatacttacgccaagtccctctatggatatccttgtgtcatccaatttggaa
cggcagctattcgaactcactgggcgtgatggttctgctatctcatattggatgaaagat
cttgctgaaaagggatgtttccgtattgatccccatacctttacgcggcttcgtgctgag
tttgcaagcgactccgtctccaacgatgagtgcttaagaaccattaaggaaacctttgat
gcacatggataccttatcgatccccatacggcagttgcctgcaaagtcgctgaacgtctt
cgttcggacaatcctgttcttgtcgccagcacagcacactgggccaaatttggcgggagc
gtctaccgagcactccatgagcttacggtgtcagatagtctgccccgtgaagtagaacag
ctaaccgactgcgaacttaacgacctgatttcccaggaaaccggatgtggacccatccct
gcaggattagcctccctggatacgatgaaggcacgtttcaccaccgttattgactctgat
aaatccgctgtcgaagaggctatttcactgtttctttcttcgattcagtaa

DBGET integrated database retrieval system