KEGG   Campylobacter curvus: CCV52592_0010Help
Entry
CCV52592_0010     CDS       T00576                                 

Definition
4Fe-4S ferredoxin iron-sulfur binding domain-containing protein
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
ccv  Campylobacter curvus
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    CCV52592_0010
Enzymes [BR:ccv01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     CCV52592_0010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1829978..1832569)
Genome map
AA seq 863 aa AA seqDB search
MQKFLNSCIAGIALLGLSFSAACSASDLEQVMKERGLSEKDVLAAAKTYQPSGRKDEFIV
FSSGGQSGQILVYGVPSMRIYKYIGVFTPEPWQGYGYDDESKAVLKQGAIRGKEITWGDT
HHPNFTEKNGEYVGDYLFINDKANPRIAVVNLHDFETTQIVVNPIMKSEHGGSFITPNSE
YVIEASQYAAPLDNNYHSIDDYEAVYRGAITFWKFDYPKGKIDEKASFSLELPPYWQDLS
DAGKGESFGWAFTNSINTEMYTGGIEKGLPPFEAGASRNDTDFMHVYNWQILEKLAKDKK
NYMEINGHRVITIKAAVDAGALFLIPESKSPHGIDVTPDGRYIIIGGKLDTHASVYDFRK
IKELIDKKDFAGTDPYGIPILDMKKALHGQVELGLGPLHNSFDSKDGIVYTSLYVDSQII
KWDYKNLKVLDKVNVHYNIGHLDTMEGKSSKPVGKYAIALDKLSIDRFNPVGPLHPQNHQ
LIDISGAKMDLIYDMPIPLGEPHDVVSIAASKLSPALTYNMGTNSRTGKPSPYVTLAGQE
RIERNGKNVTVFATMIRSHINPEHIEVNKGDNVTIHLTNLERAQDETHGFGIDLYNIHAS
LEPGKTASVNFVADMEGIFPYYCTEFCSALHLEMMGYLLVKDPNKKYESAKGNKLKALSP
EALKAEYDKVIATNKATDAVIQEVVAYLKEKHFEKYPKVKEQVEDALDQYSKIAEVKKKA
DEAYKKGDVNGAILWEYQVWQYMVKTADVGLRAKNNLAKAIATPMSAGAAKGEEAYLKGG
CNGCHVIGQVSSGPDLTGVLLRHENGEKWVADFIKDPAKFYENDYVKAMINYFNLRMPNQ
HMSDEEIKHIIEYLKWIDENAGL
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagtttttaaactcttgtatcgcgggtatcgcgctgcttgggttgtcttttagc
gcggcgtgtagcgcaagtgatcttgaacaggtcatgaaagagcgcggactcagcgagaaa
gacgtcctagcagccgccaaaacctatcagccaagcggacgaaaggacgaattcatcgta
ttttcatccggcggtcaatcaggccagatactagtttacggcgttccgtcgatgagaatt
tacaaatacatcggcgttttcacgcctgagccttggcaaggatacggctatgacgacgag
tcaaaggcagtgctaaaacaaggcgctatcaggggcaaagagataacctggggcgatacg
caccacccgaatttcaccgagaaaaacggcgaatacgtgggcgattatcttttcatcaac
gataaggccaaccctcgtatagccgtcgtaaatttacatgatttcgagaccactcagatc
gtcgtaaatccgataatgaaaagcgagcacggcggtagcttcatcactccaaacagcgaa
tacgtcatcgaagccagccaatacgcagctccgcttgataacaactaccactccatagac
gactacgaggcggtttatcgcggtgcgatcacgttttggaaattcgactatccaaagggc
aagatagacgaaaaggcctctttctcgcttgagctgcctccatactggcaagatctaagc
gacgctggtaagggagagagctttggctgggctttcacaaactcgataaataccgagatg
tatacaggcggtatcgaaaagggcttgcctccgtttgaggcgggtgctagtaggaacgat
accgacttcatgcacgtttataactggcaaattttagaaaagctagctaaggacaagaaa
aactatatggagataaacggccatagagtcatcaccattaaggctgccgtcgatgcggga
gcgctatttttgatacctgagtcaaaaagccctcacggtatagacgtgacgcctgatggc
agatacatcataatcggcggaaaactcgatactcacgcttccgtttatgactttagaaag
ataaaagagctcatagataaaaaggattttgccggtactgacccgtatggcattcctatc
ctcgatatgaaaaaagcccttcacggacaggtagaactaggccttggaccactgcacaac
tcttttgactctaaagacggcatagtctatacttcgctttatgtcgactctcagatcata
aaatgggactataaaaatttaaaggtgcttgataaggtaaatgtgcattataacatcgga
caccttgacactatggagggcaagtcctctaaaccggtaggcaaatacgccatagcgctg
gataagctttctatcgatcgcttcaatccggtaggacctcttcatccgcaaaatcaccag
ctcatcgacataagcggtgctaagatggatctaatctacgatatgcctatacctcttgga
gagcctcacgatgtcgtctctatcgcagcttccaagctaagtccggcgcttacttacaac
atgggaacaaactcaagaacaggcaagccaagcccttatgtcacccttgccggtcaagag
aggatcgagcgaaacggcaaaaatgtgaccgtgtttgcaacgatgataagaagccatatc
aaccctgagcatatcgaggtaaataagggagataacgttactatccaccttacaaactta
gagcgcgctcaagacgagactcacggctttggtatagatctatacaatatccacgcatcg
cttgagccgggcaaaacggcaagcgtaaatttcgtagccgatatggaaggcatcttccct
tactactgcacggaattttgctctgcgcttcaccttgagatgatgggatatttgctcgtt
aaagatccgaataaaaaatacgaatccgcaaaaggcaacaagctaaaagctctaagcccc
gaggctttaaaagccgagtatgacaaggtcatcgcgacaaacaaagccactgacgcggtc
atacaagaggtcgtagcgtatctgaaagaaaaacattttgaaaaatatccgaaggtaaaa
gagcaagtcgaggacgcactggatcaatacagcaagatagccgaagtcaagaaaaaagcc
gatgaggcctataaaaaaggcgacgtaaacggcgcgatcctttgggagtatcaagtatgg
caatacatggtaaaaaccgccgatgtgggtctaagggctaaaaacaatctcgcaaaagct
atcgcgactcctatgagtgcgggtgctgcaaagggcgaggaggcctatttaaaaggcgga
tgcaacggctgccacgtcatcggtcaagtaagctctggtcctgatctaacgggcgtgctt
ttgcgacacgagaacggcgagaaatgggtggctgatttcataaaagatcctgcgaaattt
tatgagaacgactatgttaaagcgatgataaattactttaacctaaggatgccaaatcag
cacatgagcgatgaggagataaagcatatcatcgaatacctaaaatggatcgatgagaac
gccggtctttaa

DBGET integrated database retrieval system