KEGG   Campylobacter curvus: CCV52592_0109Help
Entry
CCV52592_0109     CDS       T00576                                 

Gene name
hisD
Definition
(GenBank) histidinal dehydrogenase / histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ccv  Campylobacter curvus
Pathway
ccv00340  Histidine metabolism
ccv01100  Metabolic pathways
ccv01110  Biosynthesis of secondary metabolites
ccv01230  Biosynthesis of amino acids
Module
ccv_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    CCV52592_0109 (hisD)
Enzymes [BR:ccv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CCV52592_0109 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: EAU00219
UniProt: A7GXX9
Position
788307..789599
Genome map
AA seq 430 aa AA seqDB search
MKFLHSTDSDFRAKFTQLVKRSDMDMSGVLPVVSQIIDEVKNGGDEALFAQIAKFDKFSP
TSKNDLMIGVGEMSSAYDNLDNSLRLALNLAYERIKSYHERSKPANWTFKDDHGILLGAK
YTPVDRAGLYIPGGKAAYPSSLLMNAVPAIVAGVKEIVVCTPAIGGKVNPLLLAAMHLCG
IKTAFKIGGASAIAAMAYGTQSVPKVDVITGPGNIYVATAKKLVYGEVNIDMIAGPSEIG
IIADESADARHVAIDLLSQAEHDELASSFLITPVEAFGRQVQRYVEDELKTLKREPIASV
SMRNKAAIIIAKDMKECVELMNELAVEHLEIATNDALSYLDEIKHAGAIFFGHFTPEAMG
DYLAGPNHTLPTGGSARFYSPLGVENFMKRSSIISVSRKGIKELGKACMQLAEAEGLGAH
ERSIRVRLND
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttttacactctacggacagtgattttagggcgaaatttacgcagcttgtgaag
cgatcggatatggatatgagcggtgttttgcccgttgtctcgcagataatcgatgaggtg
aaaaacggcggagacgaggcgctttttgcgcagatcgctaaatttgataaatttagcccg
actagcaaaaacgatctgatgatcggtgtaggcgagatgtctagcgcctacgataacctc
gataattcgctgaggctagcgctaaatttagcttatgagcgcataaaatcatatcatgag
cgctcaaagcctgctaattggacgtttaaagacgatcatggcatcttgctgggtgcaaaa
tacacgccggtagatcgtgcggggctttatatcccgggcggcaaggcggcctatcccagc
tcgcttttgatgaacgccgtgcccgcgatagtagccggtgtaaaagagatcgtagtctgc
acaccagccatcggcggcaaggtaaatcctctcttgcttgctgcgatgcatctttgcggt
ataaaaactgcctttaagataggcggagccagcgctatcgccgcgatggcatacggcaca
caaagcgtgcctaaagtggacgtgataacaggccccggaaacatctacgtcgctacggct
aaaaagctagtttatggtgaggtgaatatcgatatgatagcaggtcctagcgagataggc
atcatcgccgatgagagcgcggacgcccgccatgtggctatcgatttgctctctcaagcc
gagcatgacgagcttgccagtagctttttgataacgccggtggaggcctttggcaggcag
gtacaaagatatgtcgaggatgagctaaagacgctaaaacgcgagcctatcgcatctgtt
agtatgcgaaacaaggccgccatcatcatcgcaaaggacatgaaagagtgcgtggagctg
atgaacgagctggcagtagagcacctagagatcgctacaaacgatgcgcttagctatctt
gacgagataaaacatgccggagcgatatttttcggacattttacgcctgaggcgatggga
gactatctggcagggccaaatcacactttgccaaccggtggtagcgcgcgtttctactca
cctttgggggttgaaaatttcatgaaaagaagctcgataatctccgtcagcagaaagggc
ataaaggagcttggcaaggcctgcatgcagctagccgaggcagaagggctaggcgctcac
gagagatcgatcagagtgcgtctaaacgactga

DBGET integrated database retrieval system