KEGG   Campylobacter curvus: CCV52592_0130Help
Entry
CCV52592_0130     CDS       T00576                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ccv  Campylobacter curvus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CCV52592_0130 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCV52592_0130 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CCV52592_0130 (thrC)
Enzymes [BR:ccv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CCV52592_0130 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(770186..771649)
Genome map
AA seq 487 aa AA seqDB search
MRLTPTRADKNEKVKNVNLSTALLNPSSIHGGLYAPTKLPKISAKAWRDLSALSYEKLAL
AIISLFKFDIDEASFKKALRRYKNFDRPNIPVEFKRLGKNLYINELYHGPTRAFKDMALQ
PFGEILSKLAQKRGENYLIMCATSGDTGPATLQTFANAKNIKAICLYPTGGTSEVQRLQM
VCMPGENLKVFGIKGNFDDAQRALKTLLASQNFKSELAKNRLLLSAANSVNFGRILFQIV
YHAYAYARLLKLGKLGKNESFDIIVPSGNFGNALGTYYAKKMGAKIGKIKISSNANNILT
ELFTTGIYDLRNKTLVKTISPAMDILLSSNVERLLFDKFGAVRTKELMDELDKNKFYKLK
AHELAALKEDFEANFCTDEECEGYINSWAKKGVAIDPHTATCLKMVDSSRINVITSTAHW
VKFTPSMLKACDVKVKGGEKEGLKKMAEILNDTVPKAIDALFDAPILHPEVIAQSQIENK
ILEWIKK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagactcacacccacaagagcggacaaaaacgaaaaggtaaaaaatgtaaatttaagc
accgcactgctaaatccaagtagcatccacggcggactttacgcaccgacgaagcttcca
aagataagcgctaaagcatggcgagatctaagcgcgttaagctacgaaaagctggcactg
gctatcatctcgctctttaaattcgacatcgatgaggcaagctttaaaaaggccttgaga
cgctataaaaatttcgaccgaccaaatataccggtcgaatttaaaaggcttggtaaaaac
ctatacataaacgagctttatcatgggcccacacgcgcttttaaggatatggcgcttcag
cctttcggcgaaattttaagcaagctcgcgcaaaaacgaggcgaaaactacctcataatg
tgcgccacgagcggcgacaccggcccggcgacgctacaaaccttcgcaaacgctaaaaat
ataaaagccatctgcttgtatcctacgggcggcacgagcgaggtccagcgactccagatg
gtctgcatgcccggcgaaaatttaaaggtctttggcataaaaggcaacttcgacgacgct
cagcgcgcactaaaaacgcttctggcgagtcaaaattttaaaagcgaactggctaaaaat
cgtcttttgctgagtgcggcaaattctgtgaattttggcaggattttgtttcagatcgtc
taccacgcatacgcttacgctcgccttttgaagcttggcaaactaggcaaaaacgagagc
tttgatatcatcgtgccaagcgggaatttcggcaacgccttggggacttattacgctaaa
aaaatgggcgcaaaaataggcaagataaagatctcttcaaacgccaacaacatcttgacc
gagctttttacgacgggcatttacgatctaaggaacaaaaccttagtcaagaccataagc
ccggccatggatatcttgctaagctctaacgtcgagcgcctactctttgataaatttggc
gccgtacgcacgaaagagctcatggacgagcttgataaaaataaattttacaagctaaag
gcgcacgaactagcagcgctaaaagaggactttgaggcaaacttttgcaccgacgaggag
tgcgaaggctacataaactcctgggctaaaaaaggcgtagcgatcgacccgcataccgca
acatgcctaaaaatggtagacagctcccgcataaacgtcataacctcgaccgcgcactgg
gtgaaatttacaccaagtatgctaaaagcctgcgacgtgaaggtaaaaggcggcgaaaaa
gaggggctcaaaaagatggctgaaattttaaacgacacagtgccaaaggcgatagatgcg
ctatttgacgcgccgatcctacaccctgaagtgatagctcaaagccagatcgaaaataaa
attttagaatggatcaaaaaatga

DBGET integrated database retrieval system