KEGG   Campylobacter curvus: CCV52592_0155Help
Entry
CCV52592_0155     CDS       T00576                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ccv  Campylobacter curvus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ccv00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ccv00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
752653..753582
Genome map
AA seq 309 aa AA seqDB search
MGYKHKDLLGTRELSKEEILYFLDAAKEFKELNLKDIKKCEYLRGKTTINAFYENSTRTR
TSFEIAAKRLGADTINFTASNSSVKKGETLNDTMNNMAAMKTDIIVLRHPSSGAAKFAAA
RTDASVVNAGDGTNEHPSQALLDLFTLLEYGKSLDKNTTVSIIGDIARSRVARSDIWAMK
KFGINVKLFAPKMMIPKDAEVFESEICKNMEEACEGSDVIIMLRIQLERADGDVAFPSSR
EYSKFFGLNKNRIKLAKPDAIVLHPGPINRGVELNSDVADGTHSVILNQVENGVAVRMAI
LNTLINNRG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgggctataaacataaggatctgctgggcaccagagagcttagcaaagaggaaattttg
tattttttagacgctgcgaaggaatttaaagagctaaatttaaaggatataaaaaaatgc
gagtatctgcgcggcaagaccacgataaacgcattttatgaaaattctacgcgcacgcgc
actagctttgagatagctgcaaagaggcttggcgcggatacgataaatttcaccgcttca
aactcgagcgtaaaaaagggtgagacgctaaacgacacgatgaataacatggctgcgatg
aaaacagatatcatcgtgcttcgtcatccaagctcgggtgcggctaaatttgcagctgcc
aggaccgatgccagcgtcgtaaatgcaggagacggcacgaacgagcatccctctcaggct
ctgctcgatctttttactctgcttgaatacggcaaaagcctcgataaaaatacaaccgtc
tctatcatcggcgatatagcaaggagccgcgtggcacgctctgatatctgggcgatgaag
aaatttggcataaacgtgaagctctttgctccaaagatgatgataccaaaagatgccgag
gtgttcgagtctgaaatttgcaaaaatatggaagaggcatgcgagggaagcgacgtcatc
ataatgctaaggatacagctcgagcgcgcggacggggacgtggcatttccaagctctagg
gagtattcgaaattttttgggctgaataagaataggataaaattagccaagcctgacgcc
atagtcttgcacccaggaccgataaaccgtggcgtggagctaaattccgacgtggccgac
ggcactcactcggtcattttaaatcaagtagaaaacggcgttgccgtgcgaatggcgatc
ctaaacacactaataaacaatcgaggctga

DBGET integrated database retrieval system