KEGG   Campylobacter curvus: CCV52592_0269Help
Entry
CCV52592_0269     CDS       T00576                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ccv  Campylobacter curvus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CCV52592_0269
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCV52592_0269
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CCV52592_0269
Enzymes [BR:ccv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CCV52592_0269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1314906..1315988)
Genome map
AA seq 360 aa AA seqDB search
MKFKCSKCGAKAPLESTKYRCECGGLYDLDFTPPKFSTDLIDKSEFSLFRYRNFMPLENE
IWREITLGEGMTATVRFDEKLFFKLDYAMPTLSFKDRGAAVLIWLCKTIGVKKVLQDSSG
NAGNSVAAYCARAGIECEIYVPKGTSQKKIDMIRAFGATATVFDGSRDETADACRKKALD
EDVYYANHVYNPMFYQGTKTYVYEIFEQLGRVPENFFLPVGNGTLLIGCELALSELLRAG
AIAKAPKIFIVQSENCAPLFGATNKPRDIVPKPTQAEGIAIGKPMRGEQILAGSYEGERE
VITIPEADIVPTRQRLARGGFYVEHTTAAIYAAYLNYIKTHELKGESIISLCGAGLKSEH
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaaatgcagtaaatgcggtgccaaagcaccgcttgagagcacgaaatatcgc
tgcgagtgtggcgggctttacgatcttgacttcacaccgcctaaattttcgacggatctt
atagataagagcgaatttagcctctttaggtaccgaaattttatgcctttagaaaatgaa
atttggcgcgagatcacgctgggcgagggcatgacggcgacggtgagatttgatgaaaag
ctatttttcaagcttgactacgcgatgcccacgctttctttcaaagaccgcggggcggct
gttttgatatggctttgcaaaactatcggcgtgaaaaaggtcttgcaagatagcagcggc
aacgccggcaactcggtagcggcatactgcgccagagcgggcatcgagtgtgaaatttac
gtaccgaagggcacatcgcaaaagaagatcgatatgataagggcgtttggcgctactgcg
acggtctttgatggctcgcgcgacgagaccgccgacgcatgccgtaaaaaggcgctagat
gaggacgtctactacgcaaaccacgtctacaacccgatgttttatcaaggcacgaagaca
tacgtttatgagattttcgagcagcttggccgtgtgcctgaaaatttctttttgccggtt
ggcaacggcacgcttctaatcggctgcgagctcgcccttagtgagcttcttagagccgga
gcgatcgctaaagcacctaaaattttcatcgtgcaaagtgagaactgcgctccgcttttt
ggcgcgacaaacaagcctcgcgatatcgtgccaaagccgacccaggccgagggcatagcc
ataggaaaaccgatgcgaggcgagcaaattttagccggctcttatgagggcgagcgcgag
gtcatcacgatcccggaggccgacatcgtgcctaccagacagcgtctagcgcgaggcgga
ttttacgtggagcacacgacagccgcgatctacgccgcgtatctaaactatataaaaacg
cacgagctaaaaggagagagcatcatatcgctttgcggagcggggctaaagagcgagcat
tga

DBGET integrated database retrieval system