KEGG   Campylobacter curvus: CCV52592_0306Help
Entry
CCV52592_0306     CDS       T00576                                 

Definition
(GenBank) phosphomannomutase/phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ccv  Campylobacter curvus
Pathway
ccv00010  Glycolysis / Gluconeogenesis
ccv00030  Pentose phosphate pathway
ccv00051  Fructose and mannose metabolism
ccv00052  Galactose metabolism
ccv00230  Purine metabolism
ccv00500  Starch and sucrose metabolism
ccv00520  Amino sugar and nucleotide sugar metabolism
ccv00521  Streptomycin biosynthesis
ccv01100  Metabolic pathways
ccv01110  Biosynthesis of secondary metabolites
ccv01120  Microbial metabolism in diverse environments
ccv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCV52592_0306
   00030 Pentose phosphate pathway
    CCV52592_0306
   00051 Fructose and mannose metabolism
    CCV52592_0306
   00052 Galactose metabolism
    CCV52592_0306
   00500 Starch and sucrose metabolism
    CCV52592_0306
   00520 Amino sugar and nucleotide sugar metabolism
    CCV52592_0306
  Nucleotide metabolism
   00230 Purine metabolism
    CCV52592_0306
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CCV52592_0306
Enzymes [BR:ccv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CCV52592_0306
    5.4.2.8  phosphomannomutase
     CCV52592_0306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV Med3
Motif
Other DBs
NCBI-ProteinID: EAU00073
UniProt: A7GZ42
Position
complement(1221720..1223087)
Genome map
AA seq 455 aa AA seqDB search
MKYDEIFREYDIRGIYEKDLNETSVKAIGLALGEKMKERGVKTLSIGHDARLSAGDLFKF
LLSGLNKAGGLKIYDIGLLPTPVGYFSVYADYFDANIMITGSHNPKEYNGFKITIKKDSF
FGQDLQKLKFDVNEIIASEVKISDDFSCEKFDILTPYVHFFVKEFSELRNFKQPFIIDCA
NGAMGVSIVPIIKSLGLNAKILYSEPDGNFPNHHPDPSEKENLKDIFKCIEKKECSLGFG
FDGDGDRIAVITPKRNIKGDELAYLYALNMKNPRVLGEVKCSQNMYDEIAKIGEVFMGKT
GHSNIKKMMKELNVDLAAEVSGHIFFKERYFGFDDALYAMMRVLELVHKGFNLDGELDKM
PPVFSTDEIKIKVSEENKFKIVEELKNRIKNGECDLPKILNIIEIDGIRIQFEGGWALVR
ASNTTPVIVTRFEAKSEELLKLLQYKLNEILLKLI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgatgaaatttttagagaatatgatatacgtggaatttatgaaaaagatctg
aatgaaacaagcgtgaaggcgatcggcttagcgcttggtgaaaaaatgaaagagcgcggt
gtaaagacgctaagtatcggccatgatgccagactaagtgccggcgatctttttaaattt
ttactaagcgggttaaataaagctggcgggctaaagatttacgatataggtctactgccg
acaccggtcggatattttagcgtttatgccgattatttcgatgcaaacataatgataacc
ggctctcataatccaaaagaatacaatggctttaaaataacgataaaaaaggatagtttt
tttggccaagatctgcagaaactaaaatttgatgtgaatgaaataatcgctagcgaggta
aaaatttcagatgattttagttgtgaaaaatttgatattttgacaccttatgtacatttt
tttgtcaaagaatttagcgaactaagaaatttcaagcagccttttatcattgactgtgca
aatggcgctatgggcgttagcatcgtgcctatcataaagtcgcttggactaaacgctaaa
attttatactccgagcctgacgggaatttcccaaatcaccacccagatcctagtgaaaaa
gaaaatttaaaagatatttttaaatgtatagaaaaaaaagagtgtagccttggtttcggc
tttgacggagacggcgataggatcgctgtgatcacacctaagcgaaacataaaaggtgac
gaacttgcatacttgtatgcgctaaatatgaaaaatccgcgagtactgggtgaggtcaaa
tgctcacaaaatatgtatgacgagatcgctaagatcggcgaggttttcatgggtaaaact
gggcatagcaatataaaaaagatgatgaaagagctaaatgtcgatctcgccgctgaagtg
agcggacatatattttttaaggagcgatactttggctttgatgatgcactctatgctatg
atgcgtgtgctggagctcgtacataaaggctttaatctagacggcgagcttgataagatg
ccaccggtttttagtaccgatgagataaaaataaaagttagtgaagaaaataaatttaag
atagtcgaagagctaaaaaatcgcataaaaaatggcgaatgcgatctacctaaaatttta
aatattatcgagatagacggtatcaggatacagtttgaaggtggctgggcactcgtgcga
gcctcaaatacgacaccagtgattgtgactaggtttgaggcgaagagtgaggaattatta
aaattattgcaatataaacttaatgaaatattgcttaaattgatttag

DBGET integrated database retrieval system