KEGG   Campylobacter curvus: CCV52592_0542Help
Entry
CCV52592_0542     CDS       T00576                                 

Definition
multi-sensor signal transduction histidine kinase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ccv  Campylobacter curvus
Brite
Enzymes [BR:ccv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CCV52592_0542
Secretion system [BR:ccv02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   CCV52592_0542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1704943..1705662
Genome map
AA seq 239 aa AA seqDB search
MKKIVLTSMIAASALFAATDAQILGFYKQIVPQGVNVEISSRHKLSDHQEYEAVVLTLNN
GSISQDEIIFTKGDLLLPDILDLKTGKSYKGELQEQMMITKLSAIYKNEDAANIIRLGND
SKKATRVMFSDPECPYCREELKNIEKTLQNENLKIILTPVHDKSALEKSYLIYKDLKSVK
SDSDKVKVLRKYFAENFKVPEHSVTDEQVAQMDNLRRKYLLAGLRSVPFFVDETILTKK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcgtattaacgagtatgatcgcggctagcgcactatttgccgcaacagat
gcgcaaattttaggcttttacaagcagatcgtcccccaaggcgtaaatgtcgaaatttca
tctcgccacaaactaagcgaccaccaagaatacgaagccgtagtcttgacgctaaataac
ggtagcattagtcaagacgagataatcttcacgaaaggcgatttgctcttacctgacatc
ctcgatcttaaaaccggcaaaagctataaaggtgagcttcaagaacaaatgatgatcacc
aagctatcagccatctataaaaacgaggatgcggccaatatcataaggcttggcaacgat
agcaaaaaggccacgagagtgatgtttagcgatccggagtgcccttactgccgtgaggag
ctaaaaaatatcgaaaaaacgctacaaaatgagaatctaaagatcatcttgacacctgtg
cacgacaaaagcgcacttgaaaagagctacctcatctacaaagacctaaaatcggtcaag
tcagacagcgacaaggtcaaagtactaaggaaatatttcgcagagaattttaaagtacca
gagcatagcgtcactgacgagcaagtcgctcaaatggacaacctaagacgcaaatacctc
ttagccggccttagaagcgttcctttcttcgtcgacgaaacgatacttactaaaaaataa

DBGET integrated database retrieval system