KEGG   Campylobacter curvus: CCV52592_0577Help
Entry
CCV52592_0577     CDS       T00576                                 

Definition
protein CysQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ccv  Campylobacter curvus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CCV52592_0577
Enzymes [BR:ccv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CCV52592_0577
Transfer RNA biogenesis [BR:ccv03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CCV52592_0577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1735454..1736266
Genome map
AA seq 270 aa AA seqDB search
MKNTDDLLTLAKVAALAAGEQIKEHYENFTLTLKADRSPLTSADLAANEAIIKILSQSDL
PVCSEEKILEPKSCENLERFWLVDPLDGTKEFIAKNGEFCVCIALIENERPMLGVIFIPH
TNELFYASEGGAFKEILDAKGKILARTNLRQSRQNGKNFILLSHRSKSLKAKSIAAKLSL
NHAKIGSAIKFCRLAEGSGGVYARFSPSCLWDNAAGDAIVCFSGGTVVDASTHLPPRYDI
KTLSSPHFIALSRENLGLLEPILDLCEDKI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaacacagatgatctactaacccttgccaaggtcgccgcactggccgccggcgag
cagataaaagagcattatgagaatttcacgctcacgctaaaggccgaccgctctccgctc
actagcgccgatctggctgcgaacgaggctatcatcaaaattttaagccaaagcgatctg
cccgtttgctcggaggagaaaattttagagcctaaaagctgcgaaaatttagagcggttc
tggctagtagacccgcttgacggcactaaagaattcatcgctaaaaacggcgaattttgc
gtctgtatcgccttgatagaaaacgagcgccctatgcttggcgtgatattcatccctcac
acgaacgagctcttttacgcgagtgagggcggagcttttaaggaaattttggacgcaaag
ggtaaaattttagccagaacaaatctgcgccaaagtaggcaaaacggcaaaaatttcatc
ttgctaagccacaggagcaaaagcctcaaggcaaaatctatcgccgcaaaactcagtcta
aatcacgctaaaataggctctgcgataaaattttgccgtctggcggagggaagtggcggc
gtttatgcgagatttagccccagctgcctttgggacaatgccgcgggcgacgcgatagtc
tgctttagcggcgggacagtcgtggacgctagcacgcatctgccgccaagatacgacata
aaaacgctctccagtcctcacttcatagctctaagccgcgaaaatttaggccttttagag
cctatcttagacctttgtgaggataaaatttag

  All links  
No link information was found.   
DBGET integrated database retrieval system