KEGG   Campylobacter curvus: CCV52592_0594Help
Entry
CCV52592_0594     CDS       T00576                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ccv  Campylobacter curvus
Pathway
ccv00900  Terpenoid backbone biosynthesis
ccv01100  Metabolic pathways
ccv01110  Biosynthesis of secondary metabolites
ccv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CCV52592_0594 (dxr)
Enzymes [BR:ccv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CCV52592_0594 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: EAU01416
UniProt: A7H0K4
Position
complement(1755572..1756669)
Genome map
AA seq 365 aa AA seqDB search
MVILGSTGSIGTNTLEICSRHGVSVEALSCAKNIALLNEQIARFRPKFVCVADESLASEV
KILKKSQIFVGAGGLLEMLEACHSQKVVNAIVGFAGLAPSLKTQELGKSLALANKESLVA
GGKFLDTAKISPIDSEHFGLKFLLQNRTAPNRLIITASGGAFYRTPMKNLAKVTPSDALK
HPNWSMGAKITIDSATMANKLFEVMEAFWLYGTSRIDALIEPTSMVHALVEFMDGSCTAH
ISRADMKLAIAHAVLENVSENVVAHADLLALKDIKFHKINLKKYPIFSLKEQVLERADLG
VVINAANEVGVFAFLKGECRFLDISRIVLAAAKRFADVKIETKDEIFAIDAEVRNFTKRG
LNAKI
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtggtaatactaggctctacaggctctatcggtacgaacactcttgaaatttgctctcgt
cacggcgtaagcgtcgaggcgctaagctgcgctaaaaatatcgctcttttaaacgagcag
attgctagatttaggcctaaattcgtctgtgtagcagatgaaagcctagctagcgaggtc
aaaattttaaaaaaatctcaaatttttgtaggcgcagggggtctgcttgagatgcttgaa
gcctgccacagccaaaaggtggtaaatgctatcgtgggatttgcagggctcgcacccagt
ctaaagacgcaagagcttggcaaaagcctggcgctggcaaataaagaaagcctggtcgca
ggcggtaaattcctggatacagccaaaatttcacctatcgacagcgagcatttcgggctt
aaatttttactgcaaaaccgcaccgcaccaaaccgcctcatcatcaccgcaagcggcggg
gcgttttaccgcacgccgatgaaaaatttagccaaagtcacgccaagtgatgctttgaaa
catccaaactggagcatgggcgcaaagatcacgatagatagcgccacgatggcgaataaa
ctctttgaagtcatggaggccttctggctttacggcacgagtaggatcgacgctctcatc
gagcctacgtcaatggtgcatgccttggtggagtttatggacggctcttgcaccgcgcat
atctcgcgtgctgatatgaagctggccatcgcgcacgccgtgcttgaaaacgtgagcgaa
aatgtcgtagcgcatgctgatctgctggctcttaaagacataaaatttcacaagataaat
ttaaaaaaatatccgatcttttcactaaaagagcaggtcttagagcgagccgatcttggc
gtggtgataaatgccgcaaacgaggtcggagtgtttgcgtttttaaagggcgagtgcagg
tttttggatatttcgcgtatcgttttggctgcggcgaagagatttgccgatgtgaaaata
gagacaaaagatgaaatttttgcgatcgacgcagaggttagaaattttacaaaaagggga
ctaaatgcaaaaatatga

DBGET integrated database retrieval system